DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1774 and Acot12

DIOPT Version :9

Sequence 1:NP_001287623.1 Gene:CG1774 / 43722 FlyBaseID:FBgn0039856 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_083066.1 Gene:Acot12 / 74156 MGIID:1921406 Length:556 Species:Mus musculus


Alignment Length:347 Identity:73/347 - (21%)
Similarity:133/347 - (38%) Gaps:62/347 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SELIRESYVNHLGRVRLGRIMEELDMFAVWICHRHVKLPKLPKGVPLPYTFVTLLVDKVEFTNLE 181
            |:.|:.::.:..|.:..|::::.:|..|.....:|..:           :.||..:|.:.|.:..
Mouse    13 SQAIQPAHADSRGELSAGQLLKWMDTTACLAAEKHAGI-----------SCVTASMDDILFEDTA 66

  Fly   182 RLQVNQDIEISGHISWAGRSSMEITIYVRQLAHGEYIDVTKAIFV----MVARNATNTGPAPINP 242
            |  :.|.|.|...::.|..:||||:|.|  :...::..:.|.:.|    .||: ........:.|
Mouse    67 R--IGQIITIRAKVTRAFSTSMEISIKV--IVQDKFTGIQKLLCVAFSTFVAK-PVGKEKVHLKP 126

  Fly   243 IEVGDETEKLIWEQAEKRQKVR--KSSAMDSVFNSPPREHEQALMYEILKRTTPANSMDLNKRVL 305
            :.:..|.|::....|.:|:|||  ..:..:::.....|..:.....|....||...|:...:.||
Mouse   127 VLLQTEQEQVEHNLASERRKVRLQHENTFNNIMKESSRFSDSICNEEEGTATTMGTSVQSIELVL 191

  Fly   306 PPKCRWMEDSMQSTMIAPFPENRNAQNTIFGGYLMRQAVEISFIMASIYLGDRPTLRCISDISFM 370
            ||                   :.|.....|||.:|.....::.|.||......|.|:.:....|.
Mouse   192 PP-------------------HANHHGNTFGGQIMAWMETVATISASRLCHGHPFLKSVDMFKFR 237

  Fly   371 HPVHVDRFLQLTAHVVYAAQNYVQLMTVAQIWDAK---SGKVQTTNVFYLTYRADKVLDEVLPRS 432
            .|..|...|..:|.|....||.|::....:.:|.:   .|:.:..|..:|.|.|           
Mouse   238 GPSTVGDRLVFSAIVNNTFQNSVEVGVRVEAFDCQEWAEGQGRHINSAFLIYNA----------- 291

  Fly   433 YREMLWYVHGRRKLLGALHLQP 454
                   |..:.||:....:||
Mouse   292 -------VDDQEKLITFPRIQP 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1774NP_001287623.1 BFIT_BACH 107..241 CDD:239526 26/127 (20%)
BFIT_BACH 310..421 CDD:239526 24/113 (21%)
Acot12NP_083066.1 BFIT_BACH 4..116 CDD:239526 26/118 (22%)
Coenzyme A binding. /evidence=ECO:0000250 54..56 1/1 (100%)
Coenzyme A binding. /evidence=ECO:0000250 83..85 0/1 (0%)
BFIT_BACH 182..306 CDD:239526 33/160 (21%)
Coenzyme A binding. /evidence=ECO:0000250 235..237 0/1 (0%)
SRPBCC 312..547 CDD:387369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.