DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1774 and acot7

DIOPT Version :9

Sequence 1:NP_001287623.1 Gene:CG1774 / 43722 FlyBaseID:FBgn0039856 Length:472 Species:Drosophila melanogaster
Sequence 2:XP_005167330.1 Gene:acot7 / 447878 ZFINID:ZDB-GENE-040912-42 Length:359 Species:Danio rerio


Alignment Length:182 Identity:43/182 - (23%)
Similarity:80/182 - (43%) Gaps:26/182 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PKREELPPRTMLDSHTTAILPLSSSELIRESYVNHLGRVRLGRIMEELDMFAVWICHRHVKLPKL 157
            |.|:...|.|::.|.::.|..:..|:.....:|:.      |..|:.:|..|..:..||.|.   
Zfish   192 PDRQTKEPFTVVCSQSSLIHLVGPSDCTLHGFVHG------GVTMKLMDEVAGIVAARHCKT--- 247

  Fly   158 PKGVPLPYTFVTLLVDKVEFTNLERLQVNQDIEISGHISWAGRSSMEITIYVR-----QLAHGEY 217
                    ..||..||.:.|.  .:::....|.:||.:::....||||.::|.     :...|:|
Zfish   248 --------NIVTASVDAINFH--RKIKKGCVITVSGRMTFTSNKSMEIEVFVDADPLVEAEKGKY 302

  Fly   218 IDVTKAIFVMVARNATNTGPAPINPIEVGDETEKLIWEQAEKRQKVRKSSAM 269
            ..|| |.|..::.:..|. |.|:.|:::..|.|:..:|:.:.|....|:..:
Zfish   303 RAVT-AFFTYISLDKENK-PLPVPPLKLEGEEEQKRFEEGKARYLQNKAKRL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1774NP_001287623.1 BFIT_BACH 107..241 CDD:239526 32/138 (23%)
BFIT_BACH 310..421 CDD:239526
acot7XP_005167330.1 BFIT_BACH 28..137 CDD:239526
BFIT_BACH 200..324 CDD:239526 34/144 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.