DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1774 and Acot11

DIOPT Version :9

Sequence 1:NP_001287623.1 Gene:CG1774 / 43722 FlyBaseID:FBgn0039856 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001334088.1 Gene:Acot11 / 329910 MGIID:1913736 Length:614 Species:Mus musculus


Alignment Length:355 Identity:80/355 - (22%)
Similarity:145/355 - (40%) Gaps:72/355 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 SELIRESYVNHLGRVRLGRIMEELDMFAVWICHRHVKLPKLPKGVPLPYTFVTLLVDKVEFTNLE 181
            |:|:...:.||.|.:.:|::::.:|..|.....||...|           .||..:|.:.|.:  
Mouse    72 SQLVLPCHTNHRGELSIGQLLKWIDTTACLSAERHAGCP-----------CVTASMDDIYFDH-- 123

  Fly   182 RLQVNQDIEISGHISWAGRSSMEITIYV--RQLAHGEYIDVTKAIFVMVA-RNATNTGPAPINPI 243
            .:.|.|.:.|...::.|..||||:.|.|  ..|...:...|.||:...|| |..:......:.|:
Mouse   124 TISVGQVVNIKAKVNRAFNSSMEVGIQVVSEDLCSEKQWSVCKALATFVAHRELSKVKLKQVIPL 188

  Fly   244 EVGDETEKLIWEQAEKRQKVRKSSAMDSVFNSPPREHEQALMY-----EILKRTTPANSMDLNKR 303
            ...::||..:   |.:|:::|                   |:|     ::|......:.:|.:..
Mouse   189 TEEEKTEHGV---AAERRRMR-------------------LVYADTIKDLLTHCVIQDDLDKDCS 231

  Fly   304 VLPPKCRWMEDSMQSTMIAPFPENRNAQNTIFGGYLMRQAVEISFIMASIYLGDRPTLRCISDIS 368
            .:.|..:...:|::..:    |.:.|.|...|||.:|.....::.|.||......|||:.|....
Mouse   232 NMVPAEKTRVESVELVL----PPHANHQGNTFGGQIMAWMENVATIAASRLCHAHPTLKAIEMFH 292

  Fly   369 FMHPVHVDRFLQLTAHVVYAAQNYVQLMTVAQIW--DAKSGKVQTTNVFYLTYRADKVLD----- 426
            |..|..|...|.|.|.|..|.::.:::....:.:  :|::.: :..|..::|:   .|||     
Mouse   293 FRGPSQVGDRLVLKAIVNNAFKHSMEVGVCVEAYRQEAETQR-RHINSAFMTF---VVLDKDDQP 353

  Fly   427 EVLP----------RSYREMLWYVHGRRKL 446
            :.||          |.|||    ...|:|:
Mouse   354 QKLPWIRPQPGEGERRYRE----ASARKKI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1774NP_001287623.1 BFIT_BACH 107..241 CDD:239526 32/126 (25%)
BFIT_BACH 310..421 CDD:239526 26/112 (23%)
Acot11NP_001334088.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.