DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1774 and Acot7

DIOPT Version :9

Sequence 1:NP_001287623.1 Gene:CG1774 / 43722 FlyBaseID:FBgn0039856 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001139533.1 Gene:Acot7 / 26759 RGDID:628856 Length:381 Species:Rattus norvegicus


Alignment Length:214 Identity:43/214 - (20%)
Similarity:86/214 - (40%) Gaps:40/214 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 ILKRTTPANSMDLNKRVL---PPKCRWMEDSMQSTMIAPFPENRNAQNTIFGGYLMRQAVEISFI 349
            :|:.|..|:...:..|.:   |..|..|...|:       |::.|....:.||.:::...|...|
  Rat    30 VLRETWWASMRAVRTRAVHHKPGHCIAMGRIMR-------PDDANVAGNVHGGTILKMIEEAGVI 87

  Fly   350 MASIYLGDRPTLRCISDIS------FMHPVHVDRFLQLTAHVVYAAQNYVQLMTVAQIWDAKSGK 408
            :::.:...:...||::.::      |:.|:.:.....::|.:.|.:::.|::.......:..:|.
  Rat    88 ISTRHCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVHVLSENILTGT 152

  Fly   409 VQTTNVFYLTY------RADKVLDEVLPRSYREMLWYVHGRRKL----LGALH------------ 451
            .:.||...|.|      ..|||| ||.|..|........||::.    |..:.            
  Rat   153 KKLTNKATLWYVPLSLKNVDKVL-EVPPIVYLRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPI 216

  Fly   452 LQPEYPDPIEVAKESSNHI 470
            |.|| |:.:..::.|..|:
  Rat   217 LNPE-PNTVSYSQSSLIHL 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1774NP_001287623.1 BFIT_BACH 107..241 CDD:239526
BFIT_BACH 310..421 CDD:239526 20/122 (16%)
Acot7NP_001139533.1 BFIT_BACH 59..164 CDD:239526 18/111 (16%)
NINJA_B 183..>208 CDD:292754 3/24 (13%)
BFIT_BACH 223..346 CDD:239526 2/12 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 343..381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.