DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1774 and T22B7.7

DIOPT Version :9

Sequence 1:NP_001287623.1 Gene:CG1774 / 43722 FlyBaseID:FBgn0039856 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_001362037.1 Gene:T22B7.7 / 180832 WormBaseID:WBGene00020674 Length:393 Species:Caenorhabditis elegans


Alignment Length:378 Identity:86/378 - (22%)
Similarity:159/378 - (42%) Gaps:46/378 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 VDVGYHTIPKPRDHLL--QHEPKREELPPRTMLDSHTTAILPLSSSELIRESYVNHLGRVRLGRI 136
            :|..|....|...||:  |..|| ..|..|.|.:|....::||::....|.:..:..|.:|:||:
 Worm    40 MDQLYDCFYKYARHLITAQSNPK-ISLESRKMAESELKVVIPLATDFKARLNMTDSYGHIRMGRL 103

  Fly   137 MEELDMFAVWICH----RHVKLPKLPKGVPLPYTFVTLLVDKVEFTNLERLQVNQDIEISGHISW 197
            :|.:|:.|...|:    ..:.|.....|. ||..|||....:...::...|...:||.:.|.::|
 Worm   104 LEAIDIVAPCACYMLNREDIALRTFETGT-LPRMFVTARFHQTSLSHGYGLSPYRDIILRGKVTW 167

  Fly   198 AGRSSMEITIYVRQLAHGEYIDVTKAIFVMVARNATNTG-PAPINPIEVGDETEKLIWEQAEKRQ 261
            ...:..|.|:.|.| ...|::   .|..|..:.:.|||. ..|.|.:......|..:.:|..:..
 Worm   168 TSENKAEATVNVIQ-NKSEFL---TARLVFASLDGTNTSQKLPTNQLLPSTPIENFLNQQRHEAN 228

  Fly   262 KVRKSSAMDSVFNSPPREHEQALMYEILKRTTPANSMDLNKRVLPPKCRWMEDSMQSTMIAPFPE 326
            ..|...........|..:..:..|          ||                .::::|.||. ||
 Worm   229 TSRPCIPELGTIELPVIKDGEVTM----------NS----------------TNVETTTIAQ-PE 266

  Fly   327 NRNAQNTIFGGYLMRQAVEISFIMASIYLGDRPTLRCISDISFMHPVHVDRFLQLTAHV--VYAA 389
            :.|...::|||:|:|:.:|.:.:.|.::......:..|.|..||..|.:...|:.:|.|  |...
 Worm   267 HENPYGSVFGGFLVRKGLETAELCAKMFSKTSVRVSSIDDAEFMKVVEIGSILKFSAFVCNVDNK 331

  Fly   390 QNYVQLMTVAQIWDAKSGKVQTTNVFYLTYRADKV--LDEVLPRSYREML--W 438
            :...|:.:..:::::.:.|.:..:.|..|:.|.:.  |.:|:|.:.:|.:  |
 Worm   332 EQKFQVNSQVEVYNSNTNKFEICDRFLFTFEAKEEINLPQVIPHNMQEFVAQW 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1774NP_001287623.1 BFIT_BACH 107..241 CDD:239526 34/138 (25%)
BFIT_BACH 310..421 CDD:239526 26/112 (23%)
T22B7.7NP_001362037.1 PLN02647 58..367 CDD:215349 76/341 (22%)
BFIT_BACH 250..374 CDD:239526 32/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162217
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55517
OrthoDB 1 1.010 - - D261460at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12655
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.