DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1774 and ACOT7

DIOPT Version :9

Sequence 1:NP_001287623.1 Gene:CG1774 / 43722 FlyBaseID:FBgn0039856 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_863654.1 Gene:ACOT7 / 11332 HGNCID:24157 Length:380 Species:Homo sapiens


Alignment Length:174 Identity:35/174 - (20%)
Similarity:72/174 - (41%) Gaps:30/174 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   325 PENRNAQNTIFGGYLMRQAVEISFIMASIYLGDRPTLRCISDIS------FMHPVHVDRFLQLTA 383
            |::.|....:.||.:::...|...|:::.:...:...||::.::      |:.|:.:.....::|
Human    62 PDDANVAGNVHGGTILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSA 126

  Fly   384 HVVYAAQNYVQLMTVAQIWDAKSGKVQTTNVFYLTY------RADKVLDEVLPRSYREMLWYVHG 442
            .:.|.:::.|::.......:..:|..:.||...|.|      ..|||| ||.|..|........|
Human   127 EITYTSKHSVEVQVNVMSENILTGAKKLTNKATLWYVPLSLKNVDKVL-EVPPVVYSRQEQEEEG 190

  Fly   443 RRKL----LGALH------------LQPEYPDPIEVAKESSNHI 470
            |::.    |..:.            |.|| |:.:..::.|..|:
Human   191 RKRYEAQKLERMETKWRNGDIVQPVLNPE-PNTVSYSQSSLIHL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1774NP_001287623.1 BFIT_BACH 107..241 CDD:239526
BFIT_BACH 310..421 CDD:239526 18/107 (17%)
ACOT7NP_863654.1 BFIT_BACH 48..163 CDD:239526 17/100 (17%)
BFIT_BACH 222..345 CDD:239526 2/12 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1607
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.