DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pygo and Col8a1

DIOPT Version :9

Sequence 1:NP_651872.1 Gene:pygo / 43718 FlyBaseID:FBgn0043900 Length:815 Species:Drosophila melanogaster
Sequence 2:NP_031765.2 Gene:Col8a1 / 12837 MGIID:88463 Length:744 Species:Mus musculus


Alignment Length:708 Identity:206/708 - (29%)
Similarity:239/708 - (33%) Gaps:269/708 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GGPPPPPHMHPHMHPHHPG-GPMGH--PHGP--------------------HPHMGGPPPMRGMS 191
            |..|.||.:.|.:.|..|. .|:|.  ||.|                    :||:  |..|:.:.
Mouse    32 GIKPLPPQIPPQIPPQIPQYQPLGQQVPHMPLGKDGLSMGKEMPHMQYGKEYPHL--PQYMKEIP 94

  Fly   192 PMHPHQMG----PGPGVGLPPHMN-------HGRPGGPGGPGGPVPMGSPMGGIAGMGGMSPMGG 245
            |:  .:||    |..|.|..|..:       .|.||..|.||.|...|..|.||.|..|.....|
Mouse    95 PV--PRMGKEVVPKKGKGEVPLASLRGEQGPRGEPGPRGPPGPPGLPGHGMPGIKGKPGPQGYPG 157

  Fly   246 MGGPSI-----SPHHMGMGGLSPMGGGPNGPNPRAMQGSPMGGPGQNSPMNSLPMGSPMGNPIGS 305
            :|.|.:     .|..|||.|..    |..||....   .|||.||        |.|.|  .|.|.
Mouse   158 IGKPGMPGMPGKPGAMGMPGAK----GEIGPKGEI---GPMGIPG--------PQGPP--GPHGL 205

  Fly   306 P-LGPPSGPG-PGNPGNTG--GPQQQQQQPPQPPMNNGQ--------------MGPPPLHSPLGN 352
            | :|.|.||| ||.||..|  ||    :.||.||...|.              .|||.:|.|  .
Mouse   206 PGIGKPGGPGLPGQPGAKGERGP----KGPPGPPGLQGPKGEKGFGMPGLPGLKGPPGMHGP--P 264

  Fly   353 GPTG-HGSHMPG--------GPIPGPG----PGPGGLVG-PGGISPAHGNNPGGSGNNMLGGNPG 403
            ||.| .|...||        ||:..||    |||.||:| ||...|......|..|.:.:.|.||
Mouse   265 GPVGLPGVGKPGVTGFPGPQGPLGKPGPPGEPGPQGLIGVPGVQGPPGMPGVGKPGQDGIPGQPG 329

  Fly   404 --GGNSNNNGSNTSNASNNNQNPHLSPAAGRLGVPTSMQSNGPSVSSVASSSVPSPATPTLTPTS 466
              ||.                        |..|:|                .:|.|         
Mouse   330 FPGGK------------------------GEQGLP----------------GLPGP--------- 345

  Fly   467 TATSMSTSVPTSSPAPPAMSPHHSLNSAGPSPGMPNSGPSPLQSPAGPNG----PNNNNSNNNNG 527
                                           ||:|..|......|.|..|    |.........|
Mouse   346 -------------------------------PGLPGVGKPGFPGPKGDRGIGGVPGVLGPRGEKG 379

  Fly   528 PMMGQMIPNAVPMQHQQHMGGGPPGHGPGPMPGMGMNQMLPPQQPSHLGPPHPNMMNHPHHPHHH 592
            |:      .|..|       |||||. || :||:          |..:||  |..:..| .|...
Mouse   380 PI------GAPGM-------GGPPGE-PG-LPGI----------PGPMGP--PGAIGFP-GPKGE 416

  Fly   593 PG--GP--PPHMMGGPGMHGGPAGMPPHMGGGPNPHMMG-----GPHGNAGPHMGHGHMGGVPG- 647
            .|  ||  ||...|.||:.|.| |.|..:|....|.|.|     ||.|..| |.|...:.|||| 
Mouse   417 GGVVGPQGPPGPKGEPGLQGFP-GKPGFLGEVGPPGMRGLPGPIGPKGEGG-HKGLPGLPGVPGL 479

  Fly   648 ------PG-PGPGGMNGPPHPHMSPHHGHPHHHHNPMGGPGPNMFGGGGGGPMGPGGPMGNMGPM 705
                  || ||..|:.|||        |.|                 |..||.||.||.|..||.
Mouse   480 LGPKGEPGIPGDQGLQGPP--------GIP-----------------GIVGPSGPIGPPGIPGPK 519

  Fly   706 G----GGPMGGPMGVGPKPMTMG-------GGKMYPPGQPMVFNPQNPNAPPIYPCGM 752
            |    .||.|.| ||| ||...|       .|.:.|.|||.:..|..|..||..|..|
Mouse   520 GEPGLPGPPGFP-GVG-KPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVM 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pygoNP_651872.1 PHD_dPYGO 749..802 CDD:277107 2/4 (50%)
Col8a1NP_031765.2 Nonhelical region (NC2) 29..118 23/89 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..395 111/411 (27%)
Triple-helical region (COL1) 119..572 181/612 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 412..439 11/27 (41%)
Collagen 445..502 CDD:189968 24/82 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 457..590 52/147 (35%)
Nonhelical region (NC1) 573..744 1/3 (33%)
C1Q 609..744 CDD:128420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.