DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaCOP and AT2G16200

DIOPT Version :9

Sequence 1:NP_001263145.1 Gene:gammaCOP / 43717 FlyBaseID:FBgn0028968 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001189534.1 Gene:AT2G16200 / 816117 AraportID:AT2G16200 Length:83 Species:Arabidopsis thaliana


Alignment Length:60 Identity:19/60 - (31%)
Similarity:33/60 - (55%) Gaps:2/60 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   820 SENVPEGTHLHTLLCSGTFRGGAEILVRAKLAL--SEGVTLNLTVRSTDQDVAELITAAI 877
            :|.|......||.|.||.:.|..::||:|:..:  |:.:.:.|.||:.|..|::.|.|.:
plant    21 TETVASNARSHTCLPSGLYIGNVKVLVKAQFGMDSSKEIVMKLAVRAEDPSVSDAIHALV 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaCOPNP_001263145.1 SEC21 11..877 CDD:227565 19/58 (33%)
HEAT repeat 402..427 CDD:293787
HEAT repeat 439..465 CDD:293787
HEAT repeat 475..505 CDD:293787
HEAT repeat 512..538 CDD:293787
COP-gamma_platf 620..761 CDD:285908
Coatomer_g_Cpla 763..877 CDD:292991 19/58 (33%)
AT2G16200NP_001189534.1 Coatomer_g_Cpla <20..80 CDD:292991 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3620
eggNOG 1 0.900 - - E1_COG5240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002163
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.