powered by:
Protein Alignment gammaCOP and AT2G16200
DIOPT Version :9
Sequence 1: | NP_001263145.1 |
Gene: | gammaCOP / 43717 |
FlyBaseID: | FBgn0028968 |
Length: | 897 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189534.1 |
Gene: | AT2G16200 / 816117 |
AraportID: | AT2G16200 |
Length: | 83 |
Species: | Arabidopsis thaliana |
Alignment Length: | 60 |
Identity: | 19/60 - (31%) |
Similarity: | 33/60 - (55%) |
Gaps: | 2/60 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 820 SENVPEGTHLHTLLCSGTFRGGAEILVRAKLAL--SEGVTLNLTVRSTDQDVAELITAAI 877
:|.|......||.|.||.:.|..::||:|:..: |:.:.:.|.||:.|..|::.|.|.:
plant 21 TETVASNARSHTCLPSGLYIGNVKVLVKAQFGMDSSKEIVMKLAVRAEDPSVSDAIHALV 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
65 |
1.000 |
Domainoid score |
I3620 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5240 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002163 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.900 |
|
Return to query results.
Submit another query.