DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaCOP and Ap3b1

DIOPT Version :9

Sequence 1:NP_001263145.1 Gene:gammaCOP / 43717 FlyBaseID:FBgn0028968 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001101116.1 Gene:Ap3b1 / 309969 RGDID:1310256 Length:794 Species:Rattus norvegicus


Alignment Length:374 Identity:70/374 - (18%)
Similarity:127/374 - (33%) Gaps:119/374 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 VTTCNLDLEGLITDSNRS----------VATLAITTLLKTGAESSVERLMKQISTFVAEISDEFK 380
            :.|.::..:|:.....:|          :.||.:..|.....|:::..|:::..|:|.....:|.
  Rat    41 IATMSIQRKGMFEPYLKSFYVRSTDPTMIKTLKLEILTNLANEANISTLLREFQTYVRSQDKQFA 105

  Fly   381 VVVVQAI--CALCTKYPRKHTVLMNFLSGMLREEGGLEYKTSIVDTIITIIEENADAKESGLSHL 443
            ...:|.|  ||                                     |.|.|..|...:||  :
  Rat   106 AATIQTIGRCA-------------------------------------TSIAEVTDTCLNGL--V 131

  Fly   444 C-----EFIEDCEHVSLAVRILHLLGKEGPFAATPSKYIRFIYNRV-ILESPIVRAAAVTAMAQF 502
            |     :.|...|.|.:..::|.:         .|:::...|.:.. :|:|..|..|..:.:...
  Rat   132 CLLSNRDEIVVAESVVVIKKLLQM---------QPAQHGEIIKHMAKLLDSITVPVARASILWLI 187

  Fly   503 GASC---PALLSNILVLLGRCQMDPDDEVRDR-----ATYYLSILNSERPELYKNYIIERENCSL 559
            |.:|   |.:..::|..:.:.....||.|:.:     |..||:  ||::.:|...||:..     
  Rat   188 GENCERVPKIAPDVLRKMAKSFTSEDDLVKLQILNLGAKLYLT--NSKQTKLLTQYILNL----- 245

  Fly   560 ALLEKSLVEHLNGDVDTRFDIS---------IVP---KAAIVKPVIANDVMLVTSSAP--RPPKI 610
                        |..|..:||.         |||   ..|:.|  .|..:.|....||  ..|..
  Rat   246 ------------GKYDQNYDIRDRTRFIRQLIVPNEKSGALSK--YAKKIFLAQKPAPLLESPFK 296

  Fly   611 TREEESAARLAQLPGIQVLGPIHRSTAP----------IQLTESETEYT 649
            .|:......|:....::..|.:..|..|          :::.||..|:|
  Rat   297 DRDHFQLGTLSHTLNVKASGYLELSNWPEVAPDPSVRNVEVIESAKEWT 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaCOPNP_001263145.1 SEC21 11..877 CDD:227565 70/374 (19%)
HEAT repeat 402..427 CDD:293787 0/24 (0%)
HEAT repeat 439..465 CDD:293787 7/30 (23%)
HEAT repeat 475..505 CDD:293787 6/30 (20%)
HEAT repeat 512..538 CDD:293787 7/30 (23%)
COP-gamma_platf 620..761 CDD:285908 8/40 (20%)
Coatomer_g_Cpla 763..877 CDD:292991
Ap3b1NP_001101116.1 Adaptin_N <1..269 CDD:279882 54/294 (18%)
SEEEED <413..>454 CDD:291463
AP3B1_C 502..646 CDD:291462
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.