DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaCOP and AT1G23935

DIOPT Version :9

Sequence 1:NP_001263145.1 Gene:gammaCOP / 43717 FlyBaseID:FBgn0028968 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_001319071.1 Gene:AT1G23935 / 2745761 AraportID:AT1G23935 Length:1282 Species:Arabidopsis thaliana


Alignment Length:392 Identity:80/392 - (20%)
Similarity:137/392 - (34%) Gaps:115/392 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EDGPSNAYQNLEKTSVLQETRTFNETPVNPRKCIHILTKILYLINQGEQLVAREATDCFFAMTKL 76
            ||.|.:.::||.|..:                 ||:|....:.:..          :|.    ||
plant   954 EDDPHDRHRNLAKLML-----------------IHMLGYPTHFVQM----------ECL----KL 987

  Fly    77 FQSKDVVLRRMVYLGIKELSSIAEDVIIVTSSLTKDMTGKEDLYRAAAIRALCSITDNTMLQAVE 141
            ..|.....:|:.|||:.        :::||.||.:|:..........|:.||.:|....|...:.
plant   988 IASPGFPEKRIGYLGLM--------LMLVTKSLKQDLNHSNQYVVGLALFALGNICSAEMAPDLA 1044

  Fly   142 RYMKQCIVDKNAAVSCAALVSSLRLANTAGDVVKRWANEAQEALNSDNIMVQYHALGLLYHIRKS 206
            ..:::.:..::..:...|.:.|.|:.....|:|:.:.|.....|...:..|....:.|.|.:...
plant  1045 PEVERLVQFRDPNIRKKAALCSTRIVRKVPDLVENFVNADASLLKEKHHGVLIRGVQLCYELCTI 1109

  Fly   207 DRLAVSKLVNKLTRGSLKSPYAVCMLIRIACKLIEEEDIPSEELSDSPLFTFIESCLRHKSEMVI 271
            :..|:.....|.|.|.:|.                        |.|      |.:|        .
plant  1110 NDEALEYFRTKCTEGLIKF------------------------LRD------ITNC--------A 1136

  Fly   272 YEAAHAIVNLKNTNPRMLSPAFSILQLFCSSPKATLRFAAVRTLNK------VAMTHPAAVTTCN 330
            |:..:.:..:  |:|        .||      :..|||  :|.|.:      ..|||..|..|.:
plant  1137 YQPEYDVAGI--TDP--------FLQ------RRLLRF--LRVLGQGDADASDLMTHILAQVTES 1183

  Fly   331 --LD-LEGLITDSNRSVAT--LAITTLLK--TGAESSVER----LMKQISTFVAEISD---EFKV 381
              :| :|..|...|..:.|  :|...|||  :|..|..||    ::||..:...|:..   ||..
plant  1184 DAVDAIEDAIAGHNSDLTTKVMAFVALLKLSSGFPSISERIKDMIVKQKGSLHLEMQQRAIEFNS 1248

  Fly   382 VV 383
            :|
plant  1249 IV 1250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaCOPNP_001263145.1 SEC21 11..877 CDD:227565 80/392 (20%)
HEAT repeat 402..427 CDD:293787
HEAT repeat 439..465 CDD:293787
HEAT repeat 475..505 CDD:293787
HEAT repeat 512..538 CDD:293787
COP-gamma_platf 620..761 CDD:285908
Coatomer_g_Cpla 763..877 CDD:292991
AT1G23935NP_001319071.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.