DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaCOP and scnn1d

DIOPT Version :9

Sequence 1:NP_001263145.1 Gene:gammaCOP / 43717 FlyBaseID:FBgn0028968 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_031762206.1 Gene:scnn1d / 100496702 XenbaseID:XB-GENE-991876 Length:604 Species:Xenopus tropicalis


Alignment Length:206 Identity:38/206 - (18%)
Similarity:74/206 - (35%) Gaps:55/206 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 RLANTAGDVVKRWANEAQEALNSDNIMVQYHALGLLYHIRKSDRLAVSKLVNKLTRGSL------ 223
            :|.|::||...:|.....:|::.   ..::|.:.::.:|.     ||..:.|..:|..:      
 Frog   188 KLCNSSGDCYYKWFWSGFDAVHE---WYKFHYINIMSNIP-----AVLNIANNFSRDYILTCHFN 244

  Fly   224 KSP-------------YAVCMLIRIACKLIEEEDIPSEELSDSPLFTFIESCLRHKSEMVIYEAA 275
            :.|             |..|..|....|  |.....|.......|...:::.| |.:..::.:||
 Frog   245 EMPCDEREYVHFHHPIYGNCFTINNHWK--ENSWYSSRPGKQYGLSIVVKTDL-HDNMPLLSQAA 306

  Fly   276 HAIVNLKNTN--PRMLSPAFSI---------------LQL-----FCSSPKATLRFAAVRTLNKV 318
            .|.:.:.|.|  |.:....|.|               ::|     .|:|..:.|   .::.|...
 Frog   307 GARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDL---GIKILYNT 368

  Fly   319 AMTHPAAVTTC 329
            :.|..|.:.:|
 Frog   369 SYTMQACLNSC 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaCOPNP_001263145.1 SEC21 11..877 CDD:227565 38/206 (18%)
HEAT repeat 402..427 CDD:293787
HEAT repeat 439..465 CDD:293787
HEAT repeat 475..505 CDD:293787
HEAT repeat 512..538 CDD:293787
COP-gamma_platf 620..761 CDD:285908
Coatomer_g_Cpla 763..877 CDD:292991
scnn1dXP_031762206.1 ENaC 18..583 CDD:273304 38/206 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165165051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.