DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nyo and cutl-3

DIOPT Version :10

Sequence 1:NP_651871.2 Gene:nyo / 43716 FlyBaseID:FBgn0039852 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_510492.2 Gene:cutl-3 / 184721 WormBaseID:WBGene00008978 Length:405 Species:Caenorhabditis elegans


Alignment Length:30 Identity:9/30 - (30%)
Similarity:11/30 - (36%) Gaps:2/30 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FPTIATAVNVGTST--EGRPIRAVRVSKNN 39
            ||...|......|.  .|||....|::..|
 Worm    89 FPVTTTVARKAASATPRGRPYNGGRMTNTN 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nyoNP_651871.2 PAN_1 121..198 CDD:459635
PAN_AP_HGF 208..286 CDD:238532
PAN_1 295..358 CDD:459635
ZP 382..618 CDD:214579
cutl-3NP_510492.2 ZP 33..306 CDD:214579 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.