DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nyo and cutl-14

DIOPT Version :10

Sequence 1:NP_651871.2 Gene:nyo / 43716 FlyBaseID:FBgn0039852 Length:805 Species:Drosophila melanogaster
Sequence 2:NP_492780.2 Gene:cutl-14 / 182018 WormBaseID:WBGene00015231 Length:270 Species:Caenorhabditis elegans


Alignment Length:274 Identity:63/274 - (22%)
Similarity:104/274 - (37%) Gaps:71/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 NVSIECRSGEMITKIRTSKLFDGKVYAKG--APKSCAVNVNNSLEFDFRMGYNDLECNVRQSAYG 440
            ||.:||....:.....|...|.|:|:..|  ..|.|.............:..:  :|.|....:|
 Worm    28 NVEVECTDTTIEAVFLTETNFLGRVFVLGHSQDKDCVSRETGRRTTSITVPRD--KCGVETVQHG 90

  Fly   441 R---YMN--DIVIQHHDMIVTSSDLGLAVSCQYDLTNKTVLNDVDLGVTGEIESSLSEEITIDSP 500
            :   |.:  :|||..||..:|..|....::|.|             ..||::   :|..:|: .|
 Worm    91 KGAGYTSSVNIVISFHDKFLTKVDRAYNITCLY-------------APTGDV---VSYALTV-QP 138

  Fly   501 NVIMKITSRDGSDMKRMA-------EVGDPLALR-FEIVEPNSPYE--------------IFVRE 543
            :::        .|::.:|       ||.|....| .|||..|:|.|              :.|.:
 Worm   139 SLL--------KDIQVLAEQPSCEYEVFDVRTRRPAEIVHVNAPLEHVWTCDGTNLDLFCMTVHD 195

  Fly   544 LVAMDGSDSAEITLIDANGCPTDQYIMGTIQKLAQNRKV---LLSQFDAFKFPSSEVVQFRALV- 604
            .|..:|.......:||:.||..|...:..::  .:|.|:   ::|:  ||:|.....|:|...| 
 Worm   196 CVINEGKSKRRSKIIDSEGCSLDTTRLPNLR--YENNKLSARVMSK--AFRFGDDVAVEFECNVR 256

  Fly   605 ------TPC-IPRC 611
                  |.| .|||
 Worm   257 LDLRNGTSCPRPRC 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nyoNP_651871.2 PAN_1 121..198 CDD:459635
PAN_AP_HGF 208..286 CDD:238532
PAN_1 295..358 CDD:459635
ZP 382..618 CDD:214579 61/270 (23%)
cutl-14NP_492780.2 ZP 32..270 CDD:214579 59/268 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.