DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mey and qsm

DIOPT Version :9

Sequence 1:NP_001287622.1 Gene:mey / 43715 FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:434 Identity:95/434 - (21%)
Similarity:161/434 - (37%) Gaps:130/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LVCRLSHHSRATLTDLSEPYLSIE----EAATYEQSACYNVSIDCRSGEMITKIRTSKLFDGKVY 428
            |.|.|:....:.....||..:.::    :|.:.:|||                        .::|
  Fly    16 LFCGLAQAKGSHKVHCSEDQMRVDIGLPDAESKDQSA------------------------PQIY 56

  Fly   429 ---AKGAP-KSCAVNVNNSLEFDLKMRYNDL-ECNVRQSAYGRYMNDIV---IQHHDMIV--TSS 483
               .||.| :.|...::.||.. .::..:|. ||.|.     |.:|.:.   :.:|.:|:  ||.
  Fly    57 LEGLKGYPDERCQPQIDGSLAV-FRLSLSDFYECGVT-----RMVNQLTGKKVYYHKIIIESTSG 115

  Fly   484 DLGLAVSCQYDLTNKTVVNNVDLGVT----------GEIESTLSEEII------VDSPNVIMKIT 532
            ...::|.|   :|..:...||.:..|          |.|...:..:::      .:...:...:|
  Fly   116 KEIVSVKC---ITTASPAYNVMMNATTGSSSTSTSSGGIHGLVKRDVLPAGFQEPEDLEITTSLT 177

  Fly   533 AR------------DGSDMKRIAEV--GDPLALRFEIVDANSP-YEIFVRELVAMDGTDSAEITL 582
            .|            ||....|...|  |.||.:...:.:.::| |.:.|..|...|...|:| ||
  Fly   178 KRAPEPRLSIGVSQDGQKFTRDLTVKSGTPLTMEINLDEDSAPVYGLGVNYLDVTDTHTSSE-TL 241

  Fly   583 IDANGCPTDQYIMSAMQKLANNRKVLLSQFDAFKFPSSELVQFRALVTPCIPRCEPVICDNDENG 647
            | ..||..|.|:......:..:  :|.::|.|||||.|..|||||.|..|:.:|....|.|::.|
  Fly   242 I-FKGCTVDPYLFENFNTIDGD--ILSAKFKAFKFPDSSYVQFRATVNVCLDKCLGTQCSNNQVG 303

  Fly   648 ELKSLLSYGRRKRSVLNGTDGVELAIKSERQKRDVSHQAAGDENILLVQSIQITDK--------- 703
                   :|||||.:.:.....|:::....|.:|:       |.:...:.:|:.:|         
  Fly   304 -------FGRRKREISSANKVYEISLAMFLQVQDI-------EGVNKNEVLQLEEKLRELKLANQ 354

  Fly   704 ---------FAFNGADA----------------PGGSGSEAGGL 722
                     ||.....|                ..|||:.:.||
  Fly   355 RLARNSRGNFAMEQTPASAQPAFVVDERELGHLSAGSGAASNGL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meyNP_001287622.1 PAN_1 146..223 CDD:278453
PAN_AP_HGF 233..311 CDD:238532
PAN_AP_HGF 319..>380 CDD:238532 3/11 (27%)
ZP 408..642 CDD:214579 64/274 (23%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 70/304 (23%)
Zona_pellucida <200..300 CDD:278526 35/103 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.