DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mey and cutl-6

DIOPT Version :10

Sequence 1:NP_651870.3 Gene:mey / 43715 FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_492000.2 Gene:cutl-6 / 189075 WormBaseID:WBGene00012165 Length:374 Species:Caenorhabditis elegans


Alignment Length:154 Identity:31/154 - (20%)
Similarity:48/154 - (31%) Gaps:45/154 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 TWENSTQSCECRDGFARISNGSCAMVSDLARGGLGLSQDSEEDEPFCVLGQAEKAATRILT--EL 95
            ||..:.:..:.......:..||.|         :||...|.     .||....||.:.:.:  ..
 Worm    12 TWSPTGRLFQVEYAMEAVKQGSAA---------IGLRSRSH-----VVLACVNKAQSELSSHQRK 62

  Fly    96 LSKYDRNLVPKMKGVDVDVELLIQRVSEISEIQSSST-----------MH------ILFSQIWHD 143
            :.|.|.::...:.|:..|..:| .|......|..|.|           :|      :...:.|..
 Worm    63 IFKVDDHIGVAIAGLTADGRVL-SRYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKR 126

  Fly   144 P--------GLSFEHEEGAHCLTN 159
            |        ||.   |.|||...|
 Worm   127 PYGVGLLVGGLD---ESGAHLYYN 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meyNP_651870.3 PRK07003 <28..>142 CDD:235906 22/127 (17%)
PAN_1 146..223 CDD:459635 6/14 (43%)
PAN_AP_HGF 233..311 CDD:238532
PAN_1 320..399 CDD:459635
ZP 408..642 CDD:214579
cutl-6NP_492000.2 ZP 38..280 CDD:214579 25/119 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.