DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mey and R07A4.4

DIOPT Version :9

Sequence 1:NP_001287622.1 Gene:mey / 43715 FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_509797.4 Gene:R07A4.4 / 187644 WormBaseID:WBGene00011075 Length:573 Species:Caenorhabditis elegans


Alignment Length:472 Identity:90/472 - (19%)
Similarity:154/472 - (32%) Gaps:112/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 DLDPTPMATPSGSSSVDEDCEPDM-------IGFELITGYVLSAPSKQLETLPGTLMLTDCLEAC 177
            ||.|....|.:|..:..:..:||:       ..||:::..:..|...:.|.           :..
 Worm   142 DLKPVKSPTFTGELATPQRPKPDIKIKKIANEQFEIVSNTIGGAEESRKEQ-----------KVA 195

  Fly   178 QANESCSAVNYETGLCVMFRSTADQLPGSLSRSQYPVFTVYAQKSCFGVRPCSKAWCIDRVQGYR 242
            ...|....:|.:           .|...:|......|..:.  ..|    |..:...:..::|..
 Worm   196 LMAEPIDNINQQ-----------QQFDNTLRNFAVEVLPIV--PDC----PLGEHSRVQIIEGVE 243

  Fly   243 LPERAKASQSVATRRDCIELCLGET-------EFTCRSANYYAHSGLCELSDMDRITLSDEANIA 300
            :...|..:..||....|::.|...|       ...||||::...:..|.:       .||..|..
 Worm   244 VSREATITFQVAILEQCVQACRVSTYADGSRLPLLCRSAHFNRATRQCSV-------YSDAINPN 301

  Fly   301 AY------DGADYLENNCAEE---PSKLCE--FKRVAGRILKTVDSVHQNVQTLDECRDLCLTA- 353
            .|      ....|:|..|..:   |.. |:  |:|:...||....|...:|.:.:||...|:.| 
 Worm   302 GYLEYKPNQNVIYIEKICIPDTVLPMS-CDDVFRRIPQHILLGHASEVISVASENECVLECIKAK 365

  Fly   354 ---PFRCHS-YDYNETGELVCRLSHHSRATLTDLSEPYLSIEEAATYEQSACYNVSIDCRSGEMI 414
               ...||| ..|.:...|.|.|:.|:|.|......|.|:            |.|.. ...|..:
 Worm   366 TLRSVACHSILHYPDFSSLNCILNVHTRHTKNQYFTPELA------------YKVDY-VELGSCV 417

  Fly   415 TKIRTSKLFDGKVYAKGAPKSCAVNVNNSLEF-DLKMRYND-LECNVRQSAYGRY-----MNDIV 472
            |...:.:|....:.........||..:|.:.. .:...:.: ..|:.:.|...|.     .|:|:
 Worm   418 TSAASGQLASRAMIPPNPFNKPAVAADNQVGVGSVTSEWTEWTHCDEKTSTRSRQRVCNGCNEII 482

  Fly   473 IQHHDMIVTSSDLGLAVSCQYDLTNKTVVNNVDLGVTGEIESTLSEEIIVDSPNVIMKITARDGS 537
               ..|...||                  ||.|:.:...|:....:|.|||......:|.|    
 Worm   483 ---QFMPCFSS------------------NNFDVALQKFIKEQQQKEAIVDQAAQAKEIDA---- 522

  Fly   538 DMKRIAEV-GDPLALRF 553
            :.|.:.:: .:|..:.|
 Worm   523 EKKLLQQLDANPTVIEF 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
meyNP_001287622.1 PAN_1 146..223 CDD:278453 9/76 (12%)
PAN_AP_HGF 233..311 CDD:238532 18/90 (20%)
PAN_AP_HGF 319..>380 CDD:238532 20/67 (30%)
ZP 408..642 CDD:214579 27/154 (18%)
R07A4.4NP_509797.4 PAN_AP 20..>73 CDD:214680
PAN_1 237..319 CDD:278453 18/88 (20%)
PAN_1 333..416 CDD:278453 25/95 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157391
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.