DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11333 and PNC1

DIOPT Version :9

Sequence 1:NP_651869.1 Gene:CG11333 / 43714 FlyBaseID:FBgn0039850 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_011478.3 Gene:PNC1 / 852846 SGDID:S000003005 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:48 Identity:14/48 - (29%)
Similarity:19/48 - (39%) Gaps:10/48 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HACANISKTMFSMLVEPVRKSMTDIFGGKPKTVVLFGLETHVCVEQTA 124
            |...|..||..:..:|   |..||       .|.:.|:....||:.||
Yeast   135 HDIWNFHKTDMNKYLE---KHHTD-------EVYIVGVALEYCVKATA 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11333NP_651869.1 YcaC_related 18..175 CDD:238494 14/48 (29%)
PNC1NP_011478.3 nicotinamidase 1..214 CDD:238493 14/48 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.