powered by:
Protein Alignment CG11333 and PNC1
DIOPT Version :9
Sequence 1: | NP_651869.1 |
Gene: | CG11333 / 43714 |
FlyBaseID: | FBgn0039850 |
Length: | 204 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_011478.3 |
Gene: | PNC1 / 852846 |
SGDID: | S000003005 |
Length: | 216 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 48 |
Identity: | 14/48 - (29%) |
Similarity: | 19/48 - (39%) |
Gaps: | 10/48 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 HACANISKTMFSMLVEPVRKSMTDIFGGKPKTVVLFGLETHVCVEQTA 124
|...|..||..:..:| |..|| .|.:.|:....||:.||
Yeast 135 HDIWNFHKTDMNKYLE---KHHTD-------EVYIVGVALEYCVKATA 172
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1335 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.