DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11333 and isoc1

DIOPT Version :9

Sequence 1:NP_651869.1 Gene:CG11333 / 43714 FlyBaseID:FBgn0039850 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_012821047.2 Gene:isoc1 / 780052 XenbaseID:XB-GENE-491284 Length:317 Species:Xenopus tropicalis


Alignment Length:182 Identity:78/182 - (42%)
Similarity:115/182 - (63%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYRLVPSKTLFMLCDVQEKFKPAIPLLSSLIENTTKLLAAGKVFQVPLLVTEQYPERLGKTVCEL 73
            |..|.|:.|:|..||:||:|:|||.....:|....:||...::..:|::.|||||:.||.||.||
 Frog   126 LGNLTPASTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIATEQYPKGLGSTVQEL 190

  Fly    74 DIKHACANISKTMFSMLVEPVRKSMTDIFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVA 138
            |:......:.||.|||::..|..::.:..|  .::|||||:|||||::|||.||:...::|.:||
 Frog   191 DLTGVKLVLPKTKFSMVLPEVEAALAETPG--VRSVVLFGVETHVCIQQTALDLIGRGVEVHIVA 253

  Fly   139 DCCASRHNQDRDLALERLRHIGCNIATSESVIFNLLGDKNNKSFKEITPLVK 190
            |..:||...||..|||||...|..|.|||:::..|:.||::..||||..|:|
 Frog   254 DATSSRSMMDRMFALERLARNGIIITTSEAILLQLVADKDHPKFKEIQNLIK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11333NP_651869.1 YcaC_related 18..175 CDD:238494 66/156 (42%)
isoc1XP_012821047.2 YcaC_related 135..289 CDD:238494 65/155 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4744
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4075
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm9400
Panther 1 1.100 - - O PTHR14119
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.