DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11333 and Isoc1

DIOPT Version :9

Sequence 1:NP_651869.1 Gene:CG11333 / 43714 FlyBaseID:FBgn0039850 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_079754.2 Gene:Isoc1 / 66307 MGIID:1913557 Length:297 Species:Mus musculus


Alignment Length:182 Identity:79/182 - (43%)
Similarity:116/182 - (63%) Gaps:2/182 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYRLVPSKTLFMLCDVQEKFKPAIPLLSSLIENTTKLLAAGKVFQVPLLVTEQYPERLGKTVCEL 73
            |..|.|..|:|..||:||:|:|||.....:|....:||...::..:|:::|||||:.||.||.|:
Mouse   106 LGNLTPPSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIITEQYPKGLGSTVQEI 170

  Fly    74 DIKHACANISKTMFSMLVEPVRKSMTDIFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVA 138
            |:......:.||.|||::..|..::.:|.|  .::|||||:|||||::|||.:||...|:|.:||
Mouse   171 DLTGVKLVLPKTKFSMVLPEVEAALAEIPG--VRSVVLFGVETHVCIQQTALELVGRGIEVHIVA 233

  Fly   139 DCCASRHNQDRDLALERLRHIGCNIATSESVIFNLLGDKNNKSFKEITPLVK 190
            |..:||...||..|||||...|..:.|||:|:..|:.||::..||||..|:|
Mouse   234 DATSSRSMMDRMFALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11333NP_651869.1 YcaC_related 18..175 CDD:238494 67/156 (43%)
Isoc1NP_079754.2 YcaC_related 115..269 CDD:238494 66/155 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833989
Domainoid 1 1.000 140 1.000 Domainoid score I4735
eggNOG 1 0.900 - - E1_COG1335
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 165 1.000 Inparanoid score I4180
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm8734
orthoMCL 1 0.900 - - OOG6_101675
Panther 1 1.100 - - O PTHR14119
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.770

Return to query results.
Submit another query.