DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11333 and isoc2

DIOPT Version :9

Sequence 1:NP_651869.1 Gene:CG11333 / 43714 FlyBaseID:FBgn0039850 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001005029.1 Gene:isoc2 / 448545 XenbaseID:XB-GENE-946952 Length:205 Species:Xenopus tropicalis


Alignment Length:204 Identity:71/204 - (34%)
Similarity:113/204 - (55%) Gaps:11/204 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKVRGPALYRLVPSKTLFMLCDVQEKFKPAIPLLSSLIENTTKLLAAGKVFQVPLLVTEQYPER 65
            ||.:|  .:.:|....::..|||:||||:.:|.....::....::|...|..::|:::||.||:.
 Frog     1 MSSLR--RIGKLGERSSILFLCDMQEKFRQSIVFFPEIVSVAARMLQGAKKLEMPVIITEHYPKG 63

  Fly    66 LGKTVCELDIKHACANISKTMFSML---VEPVRKSMTDIFGGKPKTVVLFGLETHVCVEQTAFDL 127
            ||.||.||. ........||.||||   :|...:|:.|:     :::||.|:||..|:..||.||
 Frog    64 LGPTVPELG-ADGLKKYEKTSFSMLTPEIEEKLQSIPDL-----RSIVLCGIETQACIMSTALDL 122

  Fly   128 VNDEIDVWLVADCCASRHNQDRDLALERLRHIGCNIATSESVIFNLLGDKNNKSFKEITPLVKKI 192
            ::...||.:|||.|:||...||..||.|:|..|..:.|||.|:..|||:..:..|||:..::.:.
 Frog   123 LDKGYDVHVVADACSSRSQVDRLFALSRMRQSGAFLTTSEGVLLQLLGNAKHPKFKEVQKIIMEP 187

  Fly   193 SADMQLCRV 201
            :.|..|..:
 Frog   188 APDSGLLSI 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11333NP_651869.1 YcaC_related 18..175 CDD:238494 60/159 (38%)
isoc2NP_001005029.1 YcaC_related 17..170 CDD:238494 60/158 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4744
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4075
OMA 1 1.010 - - QHG54144
OrthoDB 1 1.010 - - D1100720at2759
OrthoFinder 1 1.000 - - FOG0001690
OrthoInspector 1 1.000 - - mtm9400
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1084
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.