powered by:
Protein Alignment CG11333 and Naam
DIOPT Version :9
Sequence 1: | NP_651869.1 |
Gene: | CG11333 / 43714 |
FlyBaseID: | FBgn0039850 |
Length: | 204 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262738.1 |
Gene: | Naam / 42348 |
FlyBaseID: | FBgn0051216 |
Length: | 357 |
Species: | Drosophila melanogaster |
Alignment Length: | 75 |
Identity: | 22/75 - (29%) |
Similarity: | 31/75 - (41%) |
Gaps: | 15/75 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 KSMTDIFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVADCCASRHNQDRDLALERLRHIG 160
|..|||: :.||...|||..||.|.::......|:.||| |...:..:.|..
Fly 254 KGATDIY--------VCGLAYDVCVGATAVDALSAGYRTILIDDCC-------RGTDVHDIEHTK 303
Fly 161 CNIATSESVI 170
..:.||:.||
Fly 304 EKVNTSDGVI 313
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1335 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.