DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11333 and Naam

DIOPT Version :9

Sequence 1:NP_651869.1 Gene:CG11333 / 43714 FlyBaseID:FBgn0039850 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001262738.1 Gene:Naam / 42348 FlyBaseID:FBgn0051216 Length:357 Species:Drosophila melanogaster


Alignment Length:75 Identity:22/75 - (29%)
Similarity:31/75 - (41%) Gaps:15/75 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 KSMTDIFGGKPKTVVLFGLETHVCVEQTAFDLVNDEIDVWLVADCCASRHNQDRDLALERLRHIG 160
            |..|||:        :.||...|||..||.|.::......|:.|||       |...:..:.|..
  Fly   254 KGATDIY--------VCGLAYDVCVGATAVDALSAGYRTILIDDCC-------RGTDVHDIEHTK 303

  Fly   161 CNIATSESVI 170
            ..:.||:.||
  Fly   304 EKVNTSDGVI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11333NP_651869.1 YcaC_related 18..175 CDD:238494 22/75 (29%)
NaamNP_001262738.1 EFh 20..81 CDD:238008
EF-hand_7 21..82 CDD:290234
nicotinamidase 97..315 CDD:238493 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1335
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.