DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Loxl4

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_036017562.1 Gene:Loxl4 / 67573 MGIID:1914823 Length:771 Species:Mus musculus


Alignment Length:325 Identity:140/325 - (43%)
Similarity:180/325 - (55%) Gaps:23/325 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NKAALAGIQVLREGRVEVSFDFGA--SWGTICSTSWSMREANVVCRQLGLGYASKASQGTEH--G 98
            ||..|||.:...||.|||..:...  .|||:||..|.:.||.|.|||||||:|:.|.:.|.:  |
Mouse   434 NKVRLAGGRNSEEGVVEVQVEVNGVPRWGTVCSDHWGLTEAMVTCRQLGLGFANFALKDTWYWQG 498

  Fly    99 DSRKYPWGMVGTLCRGTERRLADCIRE-----SHYPNLCNARNHNVSIAACVSHSADLEIGLVDI 158
            ........|.|..|.|||..|..|.|.     ||.|...:|.      .||::.:.||.:....:
Mouse   499 TPEAKEVVMSGVRCSGTEMALQQCQRHGPVHCSHGPGRFSAG------VACMNSAPDLVMNAQLV 557

  Fly   159 ERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGTADVSPYANYKEW 223
            :.||.||..|:|.|.||.||:|:|..|..:  ..|:..|.|||||.:..|:|.||..|.|....|
Mouse   558 QETAYLEDRPLSMLYCAHEENCLSKSADHM--DWPYGYRRLLRFSSQIYNLGRADFRPKAGRHSW 620

  Fly   224 VWHQCHRHYHSMNVFATFDVYDLNYRKVAQGHKASFCLMDSECRPGVRQKYTCGN-TTQGISVGC 287
            :||||||||||:.||..:|:..||..|||:||||||||.|:.|..||:::|.|.| ..||::|||
Mouse   621 IWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPSGVQRRYACANFGEQGVAVGC 685

  Fly   288 ADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDYTGVRQTTRIFNC 351
            .|||...:||||||:|.| |.:  ||.:|.:||...:.|..|.||...|...|.|  |...:.||
Mouse   686 WDTYRHDIDCQWVDITDVGPGD--YIFQVVVNPTNDVAESDFSNNMIRCRCKYDG--QRVWLHNC 746

  Fly   352  351
            Mouse   747  746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 38/95 (40%)
SR 50..136 CDD:214555 38/94 (40%)
Lysyl_oxidase 149..343 CDD:279521 92/195 (47%)
Loxl4XP_036017562.1 SR 46..146 CDD:214555
SR 188..300 CDD:214555
SR 326..426 CDD:214555
SR 460..543 CDD:214555 33/88 (38%)
Lysyl_oxidase 549..747 CDD:395944 95/204 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KG1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 1 1.000 - - FOG0000389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.