DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and loxl3a

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001186799.1 Gene:loxl3a / 568839 ZFINID:ZDB-GENE-070818-2 Length:791 Species:Danio rerio


Alignment Length:337 Identity:135/337 - (40%)
Similarity:184/337 - (54%) Gaps:14/337 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VVLSQGWANLNVQNNYRNMMVRLATN--KAALAGIQVLREGRVEVSFDFGASWGTICSTSWSMRE 75
            ::...||.:.......|.:.:..|::  :..:.|.:...|||:||  ...:.||||||.:|:.||
Zfish   431 LICGDGWTSREAMVVCRQLGLGHASSGLRIRMVGGRTDHEGRLEV--QISSRWGTICSDNWTTRE 493

  Fly    76 ANVVCRQLGLGYASKASQGTEHGDSRKY-PWGMVGTLCRGTERRLADCIRESHYPNLCNARNHNV 139
            |.|.||||||.|...|...|.:.||... ...|.|..|:|.|..|.||  :.|....|.......
Zfish   494 AMVACRQLGLKYCLHAITETWYWDSSNVTEMVMSGVKCKGDEMTLTDC--QHHSVVSCKRAGAQF 556

  Fly   140 SIAA-CVSHSADLEIGLVDIERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFS 203
            |... |...::||.:....:|:|..:|..|:..|.||.||:|::..|  .:.:.|:..|.|||||
Zfish   557 SAGVICSDMASDLVLNAPLVEQTVYIEDRPLHLLYCAAEENCLAKSA--AQASWPYGHRRLLRFS 619

  Fly   204 VKASNVGTADVSPYANYKEWVWHQCHRHYHSMNVFATFDVYDLNYRKVAQGHKASFCLMDSECRP 268
            .:..|:|.||..|......||||:||||||||::|..:|:..||..|||.||||||||.|:||..
Zfish   620 SEIHNIGKADFRPRLGRHSWVWHECHRHYHSMDIFTYYDLLSLNGTKVADGHKASFCLEDTECHE 684

  Fly   269 GVRQKYTCGN-TTQGISVGCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENN 331
            ||.::|.|.| ..|||:|||.|.|...:||||:|:|.| |.|  |||:|.:||.:::.|..|.||
Zfish   685 GVSKRYECANFGEQGITVGCWDLYRHDIDCQWIDITDVSPGN--YILQVIINPNFEVAESDFTNN 747

  Fly   332 GAECLLDYTGVR 343
            ...|...|.|.|
Zfish   748 AMRCNCKYDGHR 759

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 37/87 (43%)
SR 50..136 CDD:214555 37/86 (43%)
Lysyl_oxidase 149..343 CDD:279521 90/195 (46%)
loxl3aNP_001186799.1 SR 39..138 CDD:214555
SRCR 47..139 CDD:278931
SR 179..271 CDD:214555
SRCR 181..271 CDD:278931
SR 293..393 CDD:214555
SRCR 298..393 CDD:278931
SR 460..563 CDD:214555 39/106 (37%)
SRCR 465..563 CDD:278931 38/101 (38%)
Lysyl_oxidase 568..762 CDD:279521 91/196 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28KG1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 1 1.000 - - FOG0000389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.