DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and loxl1

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001036790.1 Gene:loxl1 / 560115 ZFINID:ZDB-GENE-060503-693 Length:526 Species:Danio rerio


Alignment Length:248 Identity:93/248 - (37%)
Similarity:136/248 - (54%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 VGTLCRGTERRLADCIRESHYPNLCNARNHNVSIAACVSHSADLEIGLVDIERTARLEAVPMSRL 172
            ||::.|..:|.|.|.:.:.:|                             ::.:..::...|..|
Zfish   310 VGSVYRPQQRGLPDLVPDPNY-----------------------------VQASTYVQRAHMYSL 345

  Fly   173 TCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGTADVSPYANYKEWVWHQCHRHYHSMNV 237
            .||.||.|:::.||....|: ::.|:||||..:..|.||||..|......|.||.||:|||||:.
Zfish   346 RCAAEEKCLASSAYNAETTD-YSVRVLLRFPQRVKNQGTADFMPNRPRHTWEWHSCHQHYHSMDE 409

  Fly   238 FATFDVYDLNY-RKVAQGHKASFCLMDSECRPGVRQKYTCGNTTQGISVGCADTYTDVLDCQWVD 301
            |:.:|:.:::. ||||:||||||||.|:.|..|..::|.|...|||:|.||.|||...:||||:|
Zfish   410 FSHYDLLEVSSGRKVAEGHKASFCLEDTTCDFGHLKRYACTAHTQGLSPGCFDTYNADIDCQWID 474

  Fly   302 VTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDYTG-VRQTTRIFNCR 352
            :|.| |.|  |||::.:||:|.:.|..|.||...|.:.||| ..:||   ||:
Zfish   475 ITDVQPGN--YILKLQVNPKYLVLESDFTNNIVGCNIHYTGRYAKTT---NCK 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 7/28 (25%)
SR 50..136 CDD:214555 7/27 (26%)
Lysyl_oxidase 149..343 CDD:279521 82/196 (42%)
loxl1NP_001036790.1 Lysyl_oxidase 322..517 CDD:279521 84/226 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.