DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and si:dkey-14d8.20

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_017210934.1 Gene:si:dkey-14d8.20 / 558392 ZFINID:ZDB-GENE-041210-146 Length:807 Species:Danio rerio


Alignment Length:105 Identity:34/105 - (32%)
Similarity:47/105 - (44%) Gaps:14/105 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NMMVRLA--TNKAALAGIQVLREGRVEVSFDFGASWGTICSTSWSMREANVVCRQLGLGYASKAS 92
            |.:||||  ||..:         |||||..|  ..|||:||..|.:.:|.|:|:::|.|..|.:.
Zfish   129 NSLVRLANGTNPCS---------GRVEVLND--GQWGTVCSDGWDLSDAAVICKEMGCGSVSGSK 182

  Fly    93 QGTEHGDSRKYPWGMVGTLCRGTERRLADCIRESHYPNLC 132
            .|...|......| :....|..:|..|..|:......|.|
Zfish   183 TGAYFGQGSGPVW-LSDVQCSNSESTLRQCVLNGWGQNSC 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 27/83 (33%)
SR 50..136 CDD:214555 27/83 (33%)
Lysyl_oxidase 149..343 CDD:279521
si:dkey-14d8.20XP_017210934.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.