DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and loxa

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_996972.1 Gene:loxa / 404621 ZFINID:ZDB-GENE-040426-2398 Length:408 Species:Danio rerio


Alignment Length:197 Identity:86/197 - (43%)
Similarity:121/197 - (61%) Gaps:12/197 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GLVD-------IERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGT 211
            ||.|       |:.:..::.|||..|.||.||:|:::.||. .....:..|:||||..:..|.||
Zfish   202 GLPDLVGDPYYIQASTYVQRVPMYNLRCAAEENCLASSAYR-SSVRDYDMRMLLRFPQRVKNQGT 265

  Fly   212 ADVSPYANYKEWVWHQCHRHYHSMNVFATFDVYD-LNYRKVAQGHKASFCLMDSECRPGVRQKYT 275
            :|..|......|.||.||:|||||:.|:.:|:.| ..:|:||:||||||||.|:.|..|..::|.
Zfish   266 SDFLPSRPRYTWEWHSCHQHYHSMDEFSHYDLLDATTHRRVAEGHKASFCLEDTSCDYGYYRRYA 330

  Fly   276 CGNTTQGISVGCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDY 339
            |.:.|||:|.||.|||...:||||:|:|.| |.|  |||:|::||.|::.|..:.||...|.:.|
Zfish   331 CTSHTQGLSPGCYDTYNADIDCQWIDITDVKPGN--YILKVSVNPSYQVPESDYSNNVVRCDVRY 393

  Fly   340 TG 341
            ||
Zfish   394 TG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931
SR 50..136 CDD:214555
Lysyl_oxidase 149..343 CDD:279521 86/197 (44%)
loxaNP_996972.1 Lysyl_oxidase 204..400 CDD:279521 84/195 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.