Sequence 1: | NP_524607.1 | Gene: | Loxl1 / 43712 | FlyBaseID: | FBgn0039848 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_996972.1 | Gene: | loxa / 404621 | ZFINID: | ZDB-GENE-040426-2398 | Length: | 408 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 86/197 - (43%) |
---|---|---|---|
Similarity: | 121/197 - (61%) | Gaps: | 12/197 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 154 GLVD-------IERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGT 211
Fly 212 ADVSPYANYKEWVWHQCHRHYHSMNVFATFDVYD-LNYRKVAQGHKASFCLMDSECRPGVRQKYT 275
Fly 276 CGNTTQGISVGCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDY 339
Fly 340 TG 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Loxl1 | NP_524607.1 | SRCR | 50..137 | CDD:278931 | |
SR | 50..136 | CDD:214555 | |||
Lysyl_oxidase | 149..343 | CDD:279521 | 86/197 (44%) | ||
loxa | NP_996972.1 | Lysyl_oxidase | 204..400 | CDD:279521 | 84/195 (43%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D376277at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45817 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.020 |