Sequence 1: | NP_524607.1 | Gene: | Loxl1 / 43712 | FlyBaseID: | FBgn0039848 | Length: | 360 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002308.2 | Gene: | LOX / 4015 | HGNCID: | 6664 | Length: | 417 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 85/201 - (42%) |
---|---|---|---|
Similarity: | 122/201 - (60%) | Gaps: | 16/201 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 EIGLVD-------IERTARLEAVPMSRLTCAMEEHCVSADAY--EIRRTNPHAARILLRFSVKAS 207
Fly 208 NVGTADVSPYANYKEWVWHQCHRHYHSMNVFATFDVYDLN-YRKVAQGHKASFCLMDSECRPGVR 271
Fly 272 QKYTCGNTTQGISVGCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAEC 335
Fly 336 LLDYTG 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Loxl1 | NP_524607.1 | SRCR | 50..137 | CDD:278931 | |
SR | 50..136 | CDD:214555 | |||
Lysyl_oxidase | 149..343 | CDD:279521 | 85/201 (42%) | ||
LOX | NP_002308.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 64..89 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 137..174 | ||||
Lysyl-oxidase like | 213..417 | 83/197 (42%) | |||
Lysyl_oxidase | 213..414 | CDD:366506 | 83/197 (42%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S7297 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D376277at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45817 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.970 |