DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Loxl1

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001012125.1 Gene:Loxl1 / 315714 RGDID:1308752 Length:608 Species:Rattus norvegicus


Alignment Length:267 Identity:98/267 - (36%)
Similarity:142/267 - (53%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SQGTEHGDSRKYPWG--MVGTLCRGTE--RRLADCIRESHYPNLCNARNHNVSIAACVSHSADLE 152
            |||.|...:::   |  .||::.|..:  |.|.|.:.:.:|                        
  Rat   375 SQGGERNGAQQ---GRLSVGSVYRPNQNGRGLPDLVPDPNY------------------------ 412

  Fly   153 IGLVDIERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGTADVSPY 217
                 ::.:..::...:..|.||.||.|:::.||....|: :..|:||||..:..|.||||..|.
  Rat   413 -----VQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATD-YDLRVLLRFPQRVKNQGTADFLPN 471

  Fly   218 ANYKEWVWHQCHRHYHSMNVFATFDVYDLNY-RKVAQGHKASFCLMDSECRPGVRQKYTCGNTTQ 281
            .....|.||.||:|||||:.|:.:|:.|.:. :|||:||||||||.||.|..|..::|.|.:.||
  Rat   472 RPRHTWEWHSCHQHYHSMDEFSHYDLLDASTGKKVAEGHKASFCLEDSTCDFGNLKRYACTSHTQ 536

  Fly   282 GISVGCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDYTGVRQT 345
            |:|.||.|||...:||||:|:|.| |.|  |||:|.:||:|.:.|..|.||...|.:.|||...:
  Rat   537 GLSPGCYDTYNADIDCQWIDITDVQPGN--YILKVHVNPKYIVLESDFTNNVVRCNIHYTGRFVS 599

  Fly   346 TRIFNCR 352
            |.  ||:
  Rat   600 TT--NCK 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 12/48 (25%)
SR 50..136 CDD:214555 12/47 (26%)
Lysyl_oxidase 149..343 CDD:279521 83/195 (43%)
Loxl1NP_001012125.1 Lysyl_oxidase 404..598 CDD:279521 73/195 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.