DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Loxl3

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001101336.1 Gene:Loxl3 / 312478 RGDID:1311011 Length:754 Species:Rattus norvegicus


Alignment Length:327 Identity:134/327 - (40%)
Similarity:177/327 - (54%) Gaps:29/327 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KAALAGIQVLREGRVEVSFDFGA--SWGTICSTSWSMREANVVCRQLGLGYASKASQGTEHGDSR 101
            |..|:|.:...||||||......  .||.||...|...||.|.|||||||||:...|.|.:.|| 
  Rat   417 KIRLSGGRSRYEGRVEVQIGVPGHLRWGLICGDDWGTLEAMVACRQLGLGYANHGLQETWYWDS- 480

  Fly   102 KYPWG------MVGTLCRGTERRLADCIRESHYPNLCNARNHNVSIAA---CVSHSADLEIGLVD 157
                |      |.|..|.|:|..|..|   :|:......:.......|   |...::||.:....
  Rat   481 ----GNVTEVVMSGVRCTGSELSLNQC---AHHNTHVTCKRTGTRFTAGVICSETASDLLLHSAL 538

  Fly   158 IERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTN-PHAARILLRFSVKASNVGTADVSPYANYK 221
            ::.||.:|..|:..|.||.||:|:::.|   |..| |:..|.|||||.:..|:|.||..|.|...
  Rat   539 VQETAYIEDRPLHMLYCAAEENCLASSA---RSANWPYGHRRLLRFSSQIHNLGRADFRPKAGRH 600

  Fly   222 EWVWHQCHRHYHSMNVFATFDVYDLNYRKVAQGHKASFCLMDSECRPGVRQKYTCGN-TTQGISV 285
            .||||:||.|||||::|..:|:...|..|||:||||||||.|:||:..|.::|.|.| ..|||:|
  Rat   601 SWVWHECHGHYHSMDIFTHYDILTPNGTKVAEGHKASFCLEDTECQEDVSKRYECANFGEQGITV 665

  Fly   286 GCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDYTGVRQTTRIF 349
            ||.|.|...:||||:|:|.| |.|  |||:|.:||.:::.|..|.||..:|...|.|.|  ..:.
  Rat   666 GCWDLYRHDIDCQWIDITDVKPGN--YILQVVINPNFEVAESDFTNNAMKCNCKYDGHR--IWVH 726

  Fly   350 NC 351
            ||
  Rat   727 NC 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 36/94 (38%)
SR 50..136 CDD:214555 36/93 (39%)
Lysyl_oxidase 149..343 CDD:279521 90/196 (46%)
Loxl3NP_001101336.1 SR 46..145 CDD:214555
SRCR 54..146 CDD:278931
SR 170..282 CDD:214555
SRCR 187..282 CDD:278931
SR 308..408 CDD:214555
SRCR 313..408 CDD:278931
SR 418..526 CDD:214555 39/115 (34%)
SRCR 423..526 CDD:278931 37/110 (34%)
Lysyl_oxidase 531..725 CDD:279521 91/200 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 1 1.000 - - FOG0000389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.