DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Marco

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_034896.1 Gene:Marco / 17167 MGIID:1309998 Length:518 Species:Mus musculus


Alignment Length:124 Identity:37/124 - (29%)
Similarity:52/124 - (41%) Gaps:30/124 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NYRNMMVRLATNKAALAGIQVLREGRVEVSFDFGASWGTICSTSWSMREANVVCRQLGLGYASKA 91
            :::.:.:...||:           ||.||.::  ..|||||...|...:|.|.||.||.   |:.
Mouse   419 SFQRVRIMGGTNR-----------GRAEVYYN--NEWGTICDDDWDNNDATVFCRMLGY---SRG 467

  Fly    92 SQGTEHGDSRKYPWGMVGTLCRGTERRLADCIRESHYPNLCNARNHNVSIAACVSHSAD 150
            ...:.:|......| :....|||||..|.||.:.|.       .|||     || |:.|
Mouse   468 RALSSYGGGSGNIW-LDNVNCRGTENSLWDCSKNSW-------GNHN-----CV-HNED 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 28/86 (33%)
SR 50..136 CDD:214555 28/85 (33%)
Lysyl_oxidase 149..343 CDD:279521 1/2 (50%)
MarcoNP_034896.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..426 0/6 (0%)
Collagen 150..207 CDD:189968
Collagen 192..249 CDD:189968
Collagen 264..323 CDD:189968
Collagen 360..418 CDD:189968
SR 423..518 CDD:214555 37/120 (31%)
SRCR 428..518 CDD:278931 37/115 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.