DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Loxl1

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_034859.2 Gene:Loxl1 / 16949 MGIID:106096 Length:607 Species:Mus musculus


Alignment Length:267 Identity:98/267 - (36%)
Similarity:142/267 - (53%) Gaps:43/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SQGTEHGDSRKYPWG--MVGTLCRGTE--RRLADCIRESHYPNLCNARNHNVSIAACVSHSADLE 152
            |||.|...:::   |  .||::.|..:  |.|.|.:.:.:|                        
Mouse   374 SQGGERNGAQQ---GRLS
VGSVYRPNQNGRGLPDLVPDPNY------------------------ 411

  Fly   153 IGLVDIERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGTADVSPY 217
                 ::.:..::...:..|.||.||.|:::.||....|: :..|:||||..:..|.||||..|.
Mouse   412 -----VQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATD-YDLRVLLRFPQRVKNQGTADFLPN 470

  Fly   218 ANYKEWVWHQCHRHYHSMNVFATFDVYDLNY-RKVAQGHKASFCLMDSECRPGVRQKYTCGNTTQ 281
            .....|.||.||:|||||:.|:.:|:.|.:. :|||:||||||||.||.|..|..::|.|.:.||
Mouse   471 RPRHTWEWHSCHQHYHSMDEFSHYDLLDASTGKKVAEGHKASFCLEDSTCDFGNLKRYACTSHTQ 535

  Fly   282 GISVGCADTYTDVLDCQWVDVTRV-PINRRYILRVALNPEYKLGEISFENNGAECLLDYTGVRQT 345
            |:|.||.|||...:||||:|:|.| |.|  |||:|.:||:|.:.|..|.||...|.:.|||...:
Mouse   536 GLSPGCYDTYNADIDCQWIDITDVQPGN--YILKVHVNPKYIVLESDFTNNVVRCNIHYTGRYVS 598

  Fly   346 TRIFNCR 352
            |.  ||:
Mouse   599 TT--NCK 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 12/48 (25%)
SR 50..136 CDD:214555 12/47 (26%)
Lysyl_oxidase 149..343 CDD:279521 83/195 (43%)
Loxl1NP_034859.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..111
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..388 4/13 (31%)
Lysyl-oxidase like 403..607 77/205 (38%)
Lysyl_oxidase 403..597 CDD:279521 73/195 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45817
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.