DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Cd5l

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_033820.2 Gene:Cd5l / 11801 MGIID:1334419 Length:352 Species:Mus musculus


Alignment Length:233 Identity:63/233 - (27%)
Similarity:85/233 - (36%) Gaps:70/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EGRVEVSFDFGASWGTICSTSWSMREANVVCRQLGLGYA-------SKASQGTEHGDSRKYPWGM 107
            :|||||...  :.|.|:|...|:::.:.|||||||.|.|       :|.:||       |.|..|
Mouse   151 QGRVEVLHQ--SQWSTVCKAGWNLQVSKVVCRQLGCGRALLTYGSCNKNTQG-------KGPIWM 206

  Fly   108 VGTLCRGTERRLADCIRESHYPNLCNARNHNVSIAACVSHSAD--------LEIGLV--DIERTA 162
            ....|.|.|..|..|:. |...|.|             :|..|        .|:.||  |...:.
Mouse   207 GKMSCSGQEANLRSCLL-SRLENNC-------------THGEDTWMECEDPFELKLVGGDTPCSG 257

  Fly   163 RLEA--------------------VPMSRLTCAMEEHCVSADAYEIRRT-NPHAARILLRFSVKA 206
            |||.                    |...:|.|....|    .:.:.|:. .|.|.||.|. .|..
Mouse   258 RLEVLHKGSWGSVCDDNWGEKEDQVVCKQLGCGKSLH----PSPKTRKIYGPGAGRIWLD-DVNC 317

  Fly   207 SNVGTADVSPYANYKEWVWHQCHRHYHSMNVFAT-FDV 243
            |  |......:..::.|.:|.| .|...:.|..| |||
Mouse   318 S--GKEQSLEFCRHRLWGYHDC-THKEDVEVICTDFDV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 32/93 (34%)
SR 50..136 CDD:214555 32/92 (35%)
Lysyl_oxidase 149..343 CDD:279521 30/127 (24%)
Cd5lNP_033820.2 SR 27..127 CDD:214555
SRCR 32..128 CDD:278931
SR 141..240 CDD:214555 34/111 (31%)
SRCR 146..241 CDD:278931 34/112 (30%)
SR 246..348 CDD:214555 24/109 (22%)
SRCR 251..348 CDD:278931 22/104 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000389
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.