DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and LOC101733498

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_031761233.1 Gene:LOC101733498 / 101733498 -ID:- Length:900 Species:Xenopus tropicalis


Alignment Length:258 Identity:72/258 - (27%)
Similarity:100/258 - (38%) Gaps:50/258 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLQLLVVLSQGWANLNVQNNYRNMMVRLATNKAALAGIQVLREGRVEVSFDFGASWGTICSTSWS 72
            ||.::.|:..|.::..:.|      |||:.......       ||||:...  ..|||||...|.
 Frog     4 LLPVVFVMFHGLSSAGILN------VRLSDGPDRCT-------GRVEIFVH--NEWGTICDDDWD 53

  Fly    73 MREANVVCRQLGLGYASKASQGTEHGDSRKYPWGMVGTLCRGTERRLADCIRESHYPNLCNARNH 137
            |.:|.||||:|..|.|.:|......|..:...| :....|||.|..|..|..:....:.|   :|
 Frog    54 MADAAVVCRELSCGTAIRAPPAAAFGFGKGKIW-LDNVKCRGDESLLHQCNHKKIGAHDC---DH 114

  Fly   138 NVSIAACVSHSADLEIGLVDIER--TARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILL 200
            ....:...|.|..|.....|.||  |..||..|||  :.|..|..||     :::.:..||..:.
 Frog   115 KEDASVVCSGSKTLLDLFEDSERVSTESLEPTPMS--SPAPTEPIVS-----LKQMSARAADHIE 172

  Fly   201 RFSVKASNVG---TADVSPYANYKEW------VWHQ------CHRHYH-----SMNVFATFDV 243
            ..|::..|.|   ...|..|.| ..|      :|:.      | |..|     |.|:.|.|.|
 Frog   173 PGSIRLVNGGGRCAGRVEIYYN-GTWGTVCDDLWNMSSARVVC-RQLHCGEPISANIKAFFGV 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 29/86 (34%)
SR 50..136 CDD:214555 29/85 (34%)
Lysyl_oxidase 149..343 CDD:279521 32/117 (27%)
LOC101733498XP_031761233.1 SR 23..123 CDD:214555 33/112 (29%)
SR 176..276 CDD:214555 15/60 (25%)
SR 411..511 CDD:214555
SR 560..660 CDD:214555
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000389
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.