DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Loxl1 and Gm21451

DIOPT Version :9

Sequence 1:NP_524607.1 Gene:Loxl1 / 43712 FlyBaseID:FBgn0039848 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_006519955.1 Gene:Gm21451 / 100862072 MGIID:5434806 Length:748 Species:Mus musculus


Alignment Length:285 Identity:125/285 - (43%)
Similarity:156/285 - (54%) Gaps:32/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KAALAGIQVLREGRVEVSFDFGAS--WGTICSTSWSMREANVVCRQLGLGYASKASQGT--EHGD 99
            |..|.|.:...||||||..:...|  |||:|..:|.:.||.|||||||||:||.|.|.|  .||:
Mouse   444 KVRLNGGRNPYEGRVEVLTERNGSLVWGTVCGQNWGIVEAMVVCRQLGLGFASNAFQETWYWHGN 508

  Fly   100 SRKYPWGMVGTLCRGTERRLADCIRESHYPNLCNARNHNVSIA------------ACVSHSADLE 152
            .......|.|..|.|||..||.|             .|:..:|            ||...:.||.
Mouse   509 IFANNVVMSGVKCSGTELSLAHC-------------RHDEEVACPEGGVRFGAGVACSETAPDLV 560

  Fly   153 IGLVDIERTARLEAVPMSRLTCAMEEHCVSADAYEIRRTNPHAARILLRFSVKASNVGTADVSPY 217
            :....:::||.||..|||.|.|||||:|:||.|.....|..|  |.|||||.:..|.|.:|..|.
Mouse   561 LNAEIVQQTAYLEDRPMSLLQCAMEENCLSASAVHTDPTRGH--RRLLRFSSQIHNNGQSDFRPK 623

  Fly   218 ANYKEWVWHQCHRHYHSMNVFATFDVYDLNYRKVAQGHKASFCLMDSECRPGVRQKYTCGN-TTQ 281
            .....|:||.||||||||.||..:|:..||..|||:||||||||.|:||...:::.|.|.| ..|
Mouse   624 NGRHAWIWHDCHRHYHSMEVFTYYDLLSLNGTKVAEGHKASFCLEDTECEGDIQKSYECANFGEQ 688

  Fly   282 GISVGCADTYTDVLDCQWVDVTRVP 306
            ||::||.|.|...:||||:|:|.||
Mouse   689 GITMGCWDMYRHDIDCQWIDITDVP 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Loxl1NP_524607.1 SRCR 50..137 CDD:278931 39/90 (43%)
SR 50..136 CDD:214555 39/89 (44%)
Lysyl_oxidase 149..343 CDD:279521 79/159 (50%)
Gm21451XP_006519955.1 SR 61..162 CDD:214555
SR 204..304 CDD:214555
SR 336..435 CDD:214555
SR 445..553 CDD:214555 44/120 (37%)
Lysyl_oxidase 557..721 CDD:366506 79/159 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376277at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.