DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment PNPase and APMAP

DIOPT Version :9

Sequence 1:	NP_001097990.2	Gene:	PNPase / 43710	FlyBaseID:	FBgn0039846	Length:	771	Species:	Drosophila melanogaster
Sequence 2:	NP_065392.1	Gene:	APMAP / 57136	HGNCID:	13238	Length:	416	Species:	Homo sapiens

Alignment Length:	141	Identity:	33/141 - (23%)
Similarity:	56/141 - (39%)	Gaps:	28/141 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    61 RFANGTAVCQMGD-TAVMVTAVAKAKPNPGQGFMPLVVDYRLKN----------AASGR--IPMN 112
            ||.||..:....| ..|..|.:|:.:.....|.|....|..::|          ::||.  :.|:
Human   257 RFPNGVQLSPAEDFVLVAETTMARIRRVYVSGLMKGGADLFVENMPGFPDNIRPSSSGGYWVGMS 321

  Fly   113 FMRRELGPSEKEILSAR-LIDRSLRPLFHKD--------YRTETQLVCNMLAMDAVHSPDVLAIN 168
            .:|...|.|..:.||.| .|.|.:..||.::        |....:|..:.....::|.||.|
Human   322 TIRPNPGFSMLDFLSERPWIKRMIFKLFSQETVMKFVPRYSLVLELSDSGAFRRSLHDPDGL--- 383

  Fly   169 AASMALSLSDI 179
               :|..:|::
Human   384 ---VATYISEV 391

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
PNPase	NP_001097990.2	PRK11824	42..751	CDD:236995	33/141 (23%)
APMAP	NP_065392.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..32
		YvrE	73..>320	CDD:225921	14/62 (23%)
		NHL	96..>284	CDD:302697	8/26 (31%)
		NHL repeat	102..137	CDD:271320
		NHL repeat	152..193	CDD:271320
		NHL repeat	200..252	CDD:271320
		Str_synth	201..288	CDD:304606	8/30 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1185
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900