DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PNPase and C08E8.2

DIOPT Version :9

Sequence 1:NP_001097990.2 Gene:PNPase / 43710 FlyBaseID:FBgn0039846 Length:771 Species:Drosophila melanogaster
Sequence 2:NP_507590.2 Gene:C08E8.2 / 182407 WormBaseID:WBGene00007438 Length:338 Species:Caenorhabditis elegans


Alignment Length:160 Identity:41/160 - (25%)
Similarity:65/160 - (40%) Gaps:48/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   546 VAGTRKGFTAIQADLKIPGIPLKVVMESLQ-KAT---DAKS----------NILDIMSE------ 590
            |.||:| |..:.|.|   |:.:....:.|: |:|   ||..          |.||::||      
 Worm    79 VEGTKK-FVLVDAYL---GVFIIDFSDELRPKSTQILDASKPIDGFRPNFLNDLDVISEDELIIT 139

  Fly   591 --AIREPRKYPKESWPVSETLTVEPQQRAQLIGPSGLHMKRIYLETGTSLTAVDETHFNVFAPS- 652
              :||...::       ...|.:|.|...::     ||:|   :.|||    |.....|::.|: 
 Worm   140 HSSIRHDCRH-------FFNLVLEHQGDGRI-----LHLK---ISTGT----VKVLAKNLYFPNG 185

  Fly   653 -QAAMDEAKELI-EGYMVKERVPDLEFGGI 680
             |...|:...:. |..|.:.:..|||.|.|
 Worm   186 IQLTPDKKSAIFAECSMARIKKLDLETGKI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PNPaseNP_001097990.2 PRK11824 42..751 CDD:236995 41/160 (26%)
C08E8.2NP_507590.2 Str_synth 126..207 CDD:354965 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1185
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.