DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:437 Identity:96/437 - (21%)
Similarity:152/437 - (34%) Gaps:147/437 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAVFPLPSSSHYF----------------------FALPYLKSLASLGHEITSV--SPYPQREPF 61
            :.|||.|:..|..                      ..||||..|.|......||  .|:|     
plant    21 IMVFPYPAQGHLLPLLDLTHQLCLRGLTVSIIVTPKNLPYLSPLLSAHPSAVSVVTLPFP----- 80

  Fly    62 RNIHDIPVPEVFENFNEV-----------LRIASTPRSTWQSSD------FINEYVLNLTKTVLN 109
               |...:|...||..::           ||....|...|.||.      .|:::.|..||.:  
plant    81 ---HHPLIPSGVENVKDLGGYGNPLIMASLRQLREPIVNWLSSHPNPPVALISDFFLGWTKDL-- 140

  Fly   110 NEGVRR-----------DILG--PQKPHF-----DLVIMDLWRMDVLSGLAAYFDAPIIGMASYG 156
              |:.|           .||.  ..|||.     .:.:.||.|..|                   
plant   141 --GIPRFAFFSSGAFLASILHFVSDKPHLFESTEPVCLSDLPRSPV------------------- 184

  Fly   157 TDWKIDELMGNVSPISYLQSPSSRFYDLEAYGERLLHLMERTFSYMNYK--WRHVRKQETLYSQF 219
              :|.:.|     |....|||.|:  |||:       :.:.|.::.:|.  :......|..|.::
plant   185 --FKTEHL-----PSLIPQSPLSQ--DLES-------VKDSTMNFSSYGCIFNTCECLEEDYMEY 233

  Fly   220 FPSVAERKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAE-LDHFIQGA 283
            .     ::.:||          |:.|.:||        :...||..:.|...:.|: |..::.|.
plant   234 V-----KQKVSE----------NRVFGVGP--------LSSVGLSKEDSVSNVDAKALLSWLDGC 275

  Fly   284 GESGVIYFSLGT-NVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLP--------GKPPNVFI 339
            .:..|:|...|: .|.:|...:|....|.::..    |.||..:.:.:|        |:  .:.:
plant   276 PDDSVLYICFGSQKVLTKEQCDDLALGLEKSMT----RFVWVVKKDPIPDGFEDRVAGR--GMIV 334

  Fly   340 SKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQF 386
            ..|.||.|:|:|..|..|:.|.|..|.:|::..|..:|..|...|||
plant   335 RGWAPQVAMLSHVAVGGFLIHCGWNSVLEAMASGTMILAWPMEADQF 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 96/437 (22%)
UDPGT 30..511 CDD:278624 92/428 (21%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 96/437 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.