DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT78D1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_564357.1 Gene:UGT78D1 / 839933 AraportID:AT1G30530 Length:453 Species:Arabidopsis thaliana


Alignment Length:260 Identity:53/260 - (20%)
Similarity:96/260 - (36%) Gaps:59/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 MERTFSYM----NYKWRHVRKQ-----------ETLYSQ----------FFPSVAERKPLSEISR 234
            ||.|..::    ||:.:.:.::           :.||..          |..|..|.:|    :.
plant   167 MEETLGFIPGMENYRVKDIPEEVVFEDLDSVFPKALYQMSLALPRASAVFISSFEELEP----TL 227

  Fly   235 NFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDH----FIQGAGESGVIYFSLGT 295
            |::|            |..:...:.:..|.:..||........|    ::.....:.|.|.|.||
plant   228 NYNL------------RSKLKRFLNIAPLTLLSSTSEKEMRDPHGCFAWMGKRSAASVAYISFGT 280

  Fly   296 NVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVFISK---------WFPQQAILAH 351
            .::.   ..:....:.:...|.....||..:::.:...|.. |:.:         |.||..:|.|
plant   281 VMEP---PPEELVAIAQGLESSKVPFVWSLKEKNMVHLPKG-FLDRTREQGIVVPWAPQVELLKH 341

  Fly   352 PNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQV-GLGLVLNIKQMTSEEFRSTI 415
            ..:.:.:||.|..|.:||:..|.||:|.|.|.|...|...|..| .:|::::....|.|.|...:
plant   342 EAMGVNVTHCGWNSVLESVSAGVPMIGRPILADNRLNGRAVEVVWKVGVMMDNGVFTKEGFEKCL 406

  Fly   416  415
            plant   407  406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 53/260 (20%)
UDPGT 30..511 CDD:278624 53/260 (20%)
UGT78D1NP_564357.1 GT1_Gtf-like 12..432 CDD:340817 53/260 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.