DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT85A7

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:511 Identity:103/511 - (20%)
Similarity:183/511 - (35%) Gaps:138/511 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPSSSHYFFALPYLKSLASLGHEITSVSP------------------------------YPQRE 59
            |.|:..|....|...|.|.:.|..:|.|:.                              .|:.:
plant    18 PYPAQGHINPMLKVAKLLYAKGFHVTFVNTLYNHNRLLRSRGPNALDGFPSFRFESIPDGLPETD 82

  Fly    60 PFRNIHDIPVPEVFEN-----FNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILG 119
            ..|..|...|....|.     |.|:||..:........|..:::.|::.|.......||...|..
plant    83 GDRTQHTPTVCMSIEKNCLAPFKEILRRINDKDDVPPVSCIVSDGVMSFTLDAAEELGVPEVIFW 147

  Fly   120 PQKP-------HFDLVIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSP 177
            ....       ||.|.|.        .||:.:.|      .||.:...:|.::..:..:..|   
plant   148 TNSACGFMTILHFYLFIE--------KGLSPFKD------ESYMSKEHLDTVIDWIPSMKNL--- 195

  Fly   178 SSRFYDLEAYGERLLHLMERTFS----YMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDL 238
              |..|:.:|        .||.:    .:|:..|.|.:             .::..:.|...||.
plant   196 --RLKDIPSY--------IRTTNPDNIMLNFLIREVER-------------SKRASAIILNTFDE 237

  Fly   239 VLVNQHFTLGPPRPYVPNMIQVGGLH------VDHSTEALSAELD---------HFIQGAGESGV 288
            :   :|..:...:..:|.:..:|.||      ::.::|.....|:         .::.....:.|
plant   238 L---EHDVIQSMQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWLDTKTPNSV 299

  Fly   289 IYFSLG--TNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKP----PNVFISK------ 341
            ::.:.|  |.:.:|.|.|     .....|:..:..:|.....|:.|:.    |..|:::      
plant   300 LFVNFGCITVMSAKQLEE-----FAWGLAASRKEFLWVIRPNLVVGEAMVVLPQEFLAETIDRRM 359

  Fly   342 ---WFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDH-VRQVGLGLVLN 402
               |.||:.:|:||.:..|:||.|..||:||:..|.||:..||..:|..|... ..:.|:|:.:.
plant   360 LASWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGVGIEIG 424

  Fly   403 IKQMTSEEFRSTIIRLLTN--------KSFEETARIT--AARYR-DQPMKPMETAI 447
             |.:..||. .|::|.|.:        :..||..|:.  |.||: ...:..:||.|
plant   425 -KDVKREEV-ETVVRELMDGEKGKKLREKAEEWRRLAEEATRYKHGSSVMNLETLI 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 103/511 (20%)
UDPGT 30..511 CDD:278624 101/506 (20%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 103/511 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.