DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT71C5

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_172204.1 Gene:UGT71C5 / 837235 AraportID:AT1G07240 Length:480 Species:Arabidopsis thaliana


Alignment Length:505 Identity:98/505 - (19%)
Similarity:174/505 - (34%) Gaps:180/505 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LAVFPLPSSSHYFFALPYLKSLASLGHEITSVS------PYPQR-----------EPFRNIHDIP 68
            |...|||.:.|....:.:.|.|.:|...|:.::      ||...           ||  .|..|.
plant     6 LIFVPLPETGHLLSTIEFGKRLLNLDRRISMITILSMNLPYAPHADASLASLTASEP--GIRIIS 68

  Fly    69 VPEVFENFNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDIL------GPQKPHFDL 127
            :||:.:  ...:::..|...|: ..|||::.:..|.||:       :|::      |....|...
plant    69 LPEIHD--PPPIKLLDTSSETY-ILDFIHKNIPCLRKTI-------QDLVSSSSSSGGGSSHVAG 123

  Fly   128 VIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELM------GNVSPISYLQ-----SPSSRF 181
            :|:|.:               .:|:...|.:..:...:      |.:..:.||.     :||.  
plant   124 LILDFF---------------CVGLIDIGREVNLPSYIFMTSNFGFLGVLQYLPERQRLTPSE-- 171

  Fly   182 YDLEAYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFT 246
            :| |:.||..||:                          |:...|.|...:              
plant   172 FD-ESSGEEELHI--------------------------PAFVNRVPAKVL-------------- 195

  Fly   247 LGPPRPY----VPNMIQVG-------GLHVDHSTEALSAELDHFIQGAGESGVIYFSLG-----T 295
              ||..:    ..:::::|       |:.|:..|:......:||.||.....|  :.:|     |
plant   196 --PPGVFDKLSYGSLVKIGERLHEAKGILVNSFTQVEPYAAEHFSQGRDYPHV--YPVGPVLNLT 256

  Fly   296 NVKSKSLSEDRRK-------------VLLETFASL-----PQ-------------RIVWKFEDEL 329
            ...:..|:..:.|             ||...|.|:     ||             |.:|.....:
plant   257 GRTNPGLASAQYKEMMKWLDEQPDSSVLFLCFGSMGVFPAPQITEIAHALELIGCRFIWAIRTNM 321

  Fly   330 L----PGKP-PNVFISK---------WFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLP 380
            .    |.:| |..|:.:         |.||..||||.....|::|.|..|..||:.:|.|:...|
plant   322 AGDGDPQEPLPEGFVDRTMGRGIVCSWAPQVDILAHKATGGFVSHCGWNSVQESLWYGVPIATWP 386

  Fly   381 CLFDQFRN-MDHVRQVGLGLVLNIK----------QMTSEEFRSTIIRLL 419
            ...:|..| .:.|:::||.:.:.:.          ::.|.:..:|.:|.|
plant   387 MYAEQQLNAFEMVKELGLAVEIRLDYVADGDRVTLEIVSADEIATAVRSL 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 98/505 (19%)
UDPGT 30..511 CDD:278624 94/496 (19%)
UGT71C5NP_172204.1 PLN02167 1..480 CDD:215112 98/505 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.