DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT72E2

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_201470.1 Gene:UGT72E2 / 836802 AraportID:AT5G66690 Length:481 Species:Arabidopsis thaliana


Alignment Length:461 Identity:105/461 - (22%)
Similarity:170/461 - (36%) Gaps:139/461 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 HDIPVPEVFE------NFNEVLRIASTPRSTWQSSDFINEYVLNLTKT--------------VLN 109
            |.|||.|:.:      .|:..:.:..|..::.||. |:|...:::.|.              |:.
plant    18 HVIPVIELGKRLSANNGFHVTVFVLETDAASAQSK-FLNSTGVDIVKLPSPDIYGLVDPDDHVVT 81

  Fly   110 NEGVRRDILGP----------QKPHFDLVIMDLWRMDVLSGLAAYF----------DAPIIGMAS 154
            ..||......|          |||  ..:|:||:..|.|. ||..|          :|..:|::.
plant    82 KIGVIMRAAVPALRSKIAAMHQKP--TALIVDLFGTDALC-LAKEFNMLSYVFIPTNARFLGVSI 143

  Fly   155 Y----GTDWKIDELMGNVSPISYLQSPSSRFYD-LEAYGERLLHLMERTFSYMNYKWRH------ 208
            |    ..|.| :|.....:|::.......||.| |:||      |:.....|.::. ||      
plant   144 YYPNLDKDIK-EEHTVQRNPLAIPGCEPVRFEDTLDAY------LVPDEPVYRDFV-RHGLAYPK 200

  Fly   209 -----VRKQETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFTLGP-PRPYVPNMIQVGGLHVDH 267
                 |...|.:..:...|:...|.|..::|    |.|   :.:|| .||     ||        
plant   201 ADGILVNTWEEMEPKSLKSLLNPKLLGRVAR----VPV---YPIGPLCRP-----IQ-------- 245

  Fly   268 STEALSAELDH----FIQGAGESGVIYFSLGTN--VKSKSLSEDRRKVLLETFASLPQRIVWKFE 326
                 |:|.||    ::.......|:|.|.|:.  :.:|.|:|     |........||.||...
plant   246 -----SSETDHPVLDWLNEQPNESVLYISFGSGGCLSAKQLTE-----LAWGLEQSQQRFVWVVR 300

  Fly   327 -------------------DELLPGKPPNVFISK----------WFPQQAILAHPNVKLFITHGG 362
                               ::..|...|..|:|:          |.||..||:|..|..|:||.|
plant   301 PPVDGSCCSEYVSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSHRAVGGFLTHCG 365

  Fly   363 LLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNI----KQMTSEEFRSTIIRLLTNKS 423
            ..||:||:..|.||:..|...:|..|...:.. .||:.:.:    :.::..:..:.:.:::|.|.
plant   366 WSSTLESVVGGVPMIAWPLFAEQNMNAALLSD-ELGIAVRLDDPKEDISRWKIEALVRKVMTEKE 429

  Fly   424 FEETAR 429
            .|...|
plant   430 GEAMRR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 105/461 (23%)
UDPGT 30..511 CDD:278624 105/461 (23%)
UGT72E2NP_201470.1 PLN02992 1..481 CDD:178572 105/461 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.