DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT76E1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_200766.2 Gene:UGT76E1 / 836077 AraportID:AT5G59580 Length:453 Species:Arabidopsis thaliana


Alignment Length:476 Identity:113/476 - (23%)
Similarity:169/476 - (35%) Gaps:137/476 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 RILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENFNEVLRIA 83
            |.:.:.|:|:..|....:...|:|.|.|..||                    .|...:|   |::
plant     8 RRIVLVPVPAQGHVTPIMQLGKALYSKGFSIT--------------------VVLTQYN---RVS 49

  Fly    84 STPRSTWQSSDFINEYVL----NLTKTVLNNEGVRRDILGPQKPHFDL----------------- 127
            |       |.||.:.:.|    :||::.|.|       |||.|..|.|                 
plant    50 S-------SKDFSDFHFLTIPGSLTESDLKN-------LGPFKFLFKLNQICEASFKQCIGQLLQ 100

  Fly   128 --------VIMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYL-QSPSSRFYD 183
                    |:.|.: |.........|..|.:             |....|..::: :|..|| .:
plant   101 EQGNDIACVVYDEY-MYFSQAAVKEFQLPSV-------------LFSTTSATAFVCRSVLSR-VN 150

  Fly   184 LEAYGERLLHLMERTFSYMNYKWRH-VRKQETLYSQFFPSVAERKPLSEI--SRNFDLVLVNQHF 245
            .|::   ||.:.:...|...:...| :|.::...|.|.|..:..|..||.  .|....|::|...
plant   151 AESF---LLDMKDPKVSDKEFPGLHPLRYKDLPTSAFGPLESILKVYSETVNIRTASAVIINSTS 212

  Fly   246 TL-GPPRPYVPNMIQV-----GGLHVDHSTEALSAELD----HFIQGAGESGVIYFSLGTNVKSK 300
            .| .....::...:||     |.||:..|..:...|.|    .::.......|||.|||      
plant   213 CLESSSLAWLQKQLQVPVYPIGPLHIAASAPSSLLEEDRSCLEWLNKQKIGSVIYISLG------ 271

  Fly   301 SLSEDRRKVLLETFASL---PQRIVWKFEDELLPGKP-----PNVF---------ISKWFPQQAI 348
            ||:....|.:||....|   .|..:|......:||..     |..|         |.||.||..:
plant   272 SLALMETKDMLEMAWGLRNSNQPFLWVIRPGSIPGSEWTESLPEEFSRLVSERGYIVKWAPQIEV 336

  Fly   349 LAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQ---FRNMDHVRQVGLGLVLNIKQMTSE- 409
            |.||.|..|.:|.|..||:|||..|.||:..|...||   .|.::.|.::|:.|...:.:.|.| 
plant   337 LRHPAVGGFWSHCGWNSTLESIGEGVPMICRPFTGDQKVNARYLERVWRIGVQLEGELDKGTVER 401

  Fly   410 ------------EFRSTIIRL 418
                        |.|..:|.|
plant   402 AVERLIMDEEGAEMRKRVINL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 113/476 (24%)
UDPGT 30..511 CDD:278624 110/465 (24%)
UGT76E1NP_200766.2 Glycosyltransferase_GTB_type 1..450 CDD:299143 113/476 (24%)
YjiC 7..429 CDD:224732 113/476 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.