DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UF3GT

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_200217.1 Gene:UF3GT / 835489 AraportID:AT5G54060 Length:468 Species:Arabidopsis thaliana


Alignment Length:460 Identity:96/460 - (20%)
Similarity:157/460 - (34%) Gaps:131/460 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GYSEGARI-LAVFPLPSSSHYFFALPYLKSLASLGHEITSVSP---YPQREPFR------NIHDI 67
            |.:|.:.: :.::|..:..|....|.....||..||:|..:.|   ..|.||..      ..|.|
plant     5 GSNESSSMSIVMYPWLAFGHMTPFLHLSNKLAEKGHKIVFLLPKKALNQLEPLNLYPNLITFHTI 69

  Fly    68 PVPEVFENFNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNN-----EGVRRDILGPQKPHFDL 127
            .:|:|          ...|.....:|| :..::.:|....::.     |.:.|.|    ||  ||
plant    70 SIPQV----------KGLPPGAETNSD-VPFFLTHLLAVAMDQTRPEVETIFRTI----KP--DL 117

  Fly   128 VIMDL--WRMDVLSGLAA---YFDAPIIGMASY--------------GTDWKIDELMGNVSPISY 173
            |..|.  |..::...:.|   .|:  |:..||.              |.:...:||.  .:|:.|
plant   118 VFYDSAHWIPEIAKPIGAKTVCFN--IVSAASIALSLVPSAEREVIDGKEMSGEELA--KTPLGY 178

  Fly   174 LQSPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSV--------------- 223
               |||:           :.|.......:::.|   ||.|.:.|.|...|               
plant   179 ---PSSK-----------VVLRPHEAKSLSFVW---RKHEAIGSFFDGKVTAMRNCDAIAIRTCR 226

  Fly   224 -AERKPLSEISRNFDLVLVNQHFTLGPPRP-YVPNMIQVGGLHVDHSTEALSAELDHFIQGAGES 286
             .|.|....|||.:...:    :..||..| ..||.            .:|..:...::......
plant   227 ETEGKFCDYISRQYSKPV----YLTGPVLPGSQPNQ------------PSLDPQWAEWLAKFNHG 275

  Fly   287 GVIYFSLGTNVKSKSLSEDRRKVL-LET------FASLPQRIVWKFEDELLPG-----KPPNVFI 339
            .|::.:.|:......:.:.:...| ||:      .|..|...|...|:.|..|     :...|..
plant   276 SVVFCAFGSQPVVNKIDQFQELCLGLESTGFPFLVAIKPPSGVSTVEEALPEGFKERVQGRGVVF 340

  Fly   340 SKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIK 404
            ..|..|..:|.||:|..|::|.|..|..||:.....::.:|         .|..|     :||.:
plant   341 GGWIQQPLVLNHPSVGCFVSHCGFGSMWESLMSDCQIVLVP---------QHGEQ-----ILNAR 391

  Fly   405 QMTSE 409
            .||.|
plant   392 LMTEE 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 96/460 (21%)
UDPGT 30..511 CDD:278624 93/442 (21%)
UF3GTNP_200217.1 Glycosyltransferase_GTB-type 10..462 CDD:415824 94/455 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.