DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:239 Identity:62/239 - (25%)
Similarity:92/239 - (38%) Gaps:57/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 DELMGNVSPISYLQSPSSRFYDLEAYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAER 226
            :||:..:.|:.|...|:|.|..:||..|......|:               .|..|....:|:  
plant   143 EELVPELHPLRYKDLPTSAFAPVEASVEVFKSSCEK---------------GTASSMIINTVS-- 190

  Fly   227 KPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDH------FIQGAGE 285
              ..|||   .|..:.|...:    |..|    :|.|::..|....|. ||.      ::.....
plant   191 --CLEIS---SLEWLQQELKI----PIYP----IGPLYMVSSAPPTSL-LDENESCIDWLNKQKP 241

  Fly   286 SGVIYFSLG--TNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPGK-------------PP 335
            |.|||.|||  |.:::|.:.|     :.....|..|..:|......:.|.             |.
plant   242 SSVIYISLGSFTLLETKEVLE-----MASGLVSSNQYFLWAIRPGSILGSELSNEELFSMMEIPD 301

  Fly   336 NVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGL 379
            ..:|.||..|:.:|||..|..|.:|.|..||:|||..|.|::||
plant   302 RGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGIPIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 62/239 (26%)
UDPGT 30..511 CDD:278624 62/239 (26%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 60/235 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.