DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:475 Identity:103/475 - (21%)
Similarity:176/475 - (37%) Gaps:107/475 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VCLLPGYSEGARILAV-----FPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDI 67
            |.:.|..:..|.:|||     ...||:...||      |.|.....:.| |..|......|:.| 
plant    15 VLVFPFGTHAAPLLAVTCRLATAAPSTVFSFF------STARSNSSLLS-SDIPTNIRVHNVDD- 71

  Fly    68 PVPEVFENFNEVLRIASTPRSTWQSSDFINEYVLNLTKTVLNNEGVRRDILGPQKP---HFDLVI 129
            .|||.|.       :...|:..       .|..|.....:.     ||:|...:..   .|..::
plant    72 GVPEGFV-------LTGNPQHA-------VELFLEAAPEIF-----RREIKAAETEVGRKFKCIL 117

  Fly   130 MD--LWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSPSSR-FYDLEAYGERL 191
            .|  ||    |:...|..:.....:|.||.        |..|..::|.:.:.| ...::..||| 
plant   118 TDAFLW----LAAETAAAEMKASWVAYYGG--------GATSLTAHLYTDAIRENVGVKEVGER- 169

  Fly   192 LHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAE--RKPLSEIS---RNFDLVLVNQHFTLGPP- 250
               ||.|..::: ....:|.::|.....|.::..  .|.|.::.   .....|.:|....|.|. 
plant   170 ---MEETIGFIS-GMEKIRVKDTQEGVVFGNLDSVFSKTLHQMGLALPRATAVFINSFEELDPTF 230

  Fly   251 ----RPYVPNMIQVGGLHVDHSTEALSAELDH-------FIQGAGESGVIYFSLG-----TNVKS 299
                |......:.:|.|.: .|:.:.::.|.|       :|:....:.|.|.:.|     ..|:.
plant   231 TNDFRSEFKRYLNIGPLAL-LSSPSQTSTLVHDPHGCLAWIEKRSTASVAYIAFGRVATPPPVEL 294

  Fly   300 KSLSEDRRKVLLETFASLPQRIVWKFEDELLPGKPPNVFISK---------WFPQQAILAHPNVK 355
            .::::.     ||: :.:|  .||..: |:.....|..|:.:         |.||..:|.|..:.
plant   295 VAIAQG-----LES-SKVP--FVWSLQ-EMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMG 350

  Fly   356 LFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQV-GLGLVLNIKQMTSEEFRSTIIRLL 419
            :|::|||..|.:||:..|.||:..|...|...|...|..| .:|:.::....|.:.|..::.|:|
plant   351 VFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGVFTKDGFEESLDRVL 415

  Fly   420 TN----------KSFEETAR 429
            ..          |..||.|:
plant   416 VQDDGKKMKVNAKKLEELAQ 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 103/475 (22%)
UDPGT 30..511 CDD:278624 95/448 (21%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 103/475 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.