DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and AT5G05900

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_196209.1 Gene:AT5G05900 / 830475 AraportID:AT5G05900 Length:450 Species:Arabidopsis thaliana


Alignment Length:488 Identity:108/488 - (22%)
Similarity:167/488 - (34%) Gaps:156/488 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SEGARILAVFPLPSSSHYFFALPYLKSLASLGHEITSV-----SPYPQREPFRNIHDIPVPEVFE 74
            |.|.|:: :||||........:...|.|.|.|..||.:     :|.....|......||      
plant     4 SNGLRVI-LFPLPLQGCINPMIQLAKILHSRGFSITVIHTRFNAPKASNHPLFTFLQIP------ 61

  Fly    75 NFNEVLRIASTPRSTWQSSDFINE-----YVLNLTKTVLNN--EGVRRDIL-----------GPQ 121
                               |.::|     :.:.|..|:||.  |...|:.|           |.:
plant    62 -------------------DGLSETETRTHDITLLLTLLNRSCESPFRECLTKLLQSADSETGEE 107

  Fly   122 KPHFDLVIMDLWRMDVLSG------LAAYFDAPIIGMASYGTDWKIDE-LMGNVSPISYL----- 174
            |.....:|.|       ||      :|..|:.|.:.:.:|...:..|. ::..:....||     
plant   108 KQRISCLIDD-------SGWIFTQPVAQSFNLPRLVLNTYKVSFFRDHFVLPQLRREMYLPLQDS 165

  Fly   175 ---QSPSSRFYDLEAYGERLLHLM----ERTFSYMNYKWRHVRKQETLYSQFFPSVAE---RKPL 229
               ..|...|..|..  :.||.::    |:..||.|......:....|   .|.|..|   :..|
plant   166 EQGDDPVEEFPPLRK--KDLLQILDQESEQLDSYSNMILETTKASSGL---IFVSTCEELDQDSL 225

  Fly   230 SEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDH----FIQGAGESGVIY 290
            |:...::.:.:    ||:||...|.|.           |:.:|.. :|.    ::....:..|||
plant   226 SQAREDYQVPI----FTIGPSHSYFPG-----------SSSSLFT-VDETCIPWLDKQEDKSVIY 274

  Fly   291 FSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLP-----------------------G 332
            .|.|      |:|.......:|        |.|...:...|                       |
plant   275 VSFG------SISTIGEAEFME--------IAWALRNSDQPFLWVVRGGSVVHGAEWIEQLHEKG 325

  Fly   333 KPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRN---MDHVRQ 394
            |     |..|.|||.:|.|..:..|:||.|..||:||:..|.||:.:|.::||..|   :..|..
plant   326 K-----IVNWAPQQEVLKHQAIGGFLTHNGWNSTVESVFEGVPMICMPFVWDQLLNARFVSDVWM 385

  Fly   395 VGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEET 427
            |||.|...|::        .:|..:..:.|.||
plant   386 VGLHLEGRIER--------NVIEGMIRRLFSET 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 108/488 (22%)
UDPGT 30..511 CDD:278624 101/473 (21%)
AT5G05900NP_196209.1 Glycosyltransferase_GTB_type 2..447 CDD:299143 108/488 (22%)
YjiC 8..436 CDD:224732 106/484 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.