DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT73B1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_567955.1 Gene:UGT73B1 / 829561 AraportID:AT4G34138 Length:488 Species:Arabidopsis thaliana


Alignment Length:222 Identity:58/222 - (26%)
Similarity:84/222 - (37%) Gaps:62/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 ETLYSQFFPS-VAERK----PLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEAL 272
            |..||.:|.| ||:|.    |||..:|.|:                            :.:....
plant   233 EQAYSDYFKSFVAKRAWHIGPLSLGNRKFE----------------------------EKAERGK 269

  Fly   273 SAELDH-----FIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQR---IVW------ 323
            .|.:|.     ::.......|||.:.||      :|..:.:.|:|..|.|...   .||      
plant   270 KASIDEHECLKWLDSKKCDSVIYMAFGT------MSSFKNEQLIEIAAGLDMSGHDFVWVVNRKG 328

  Fly   324 ---KFEDELLPG-----KPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLP 380
               :.||.|..|     |...:.|..|.||..||.|..:..|:||.|..|.:|.:..|.||:..|
plant   329 SQVEKEDWLPEGFEEKTKGKGLIIRGWAPQVLILEHKAIGGFLTHCGWNSLLEGVAAGLPMVTWP 393

  Fly   381 CLFDQFRNMDHVRQV-GLGLVLNIKQM 406
            ...:||.|...|.|| ..|:.:.:|:|
plant   394 VGAEQFYNEKLVTQVLKTGVSVGVKKM 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 58/222 (26%)
UDPGT 30..511 CDD:278624 58/222 (26%)
UGT73B1NP_567955.1 PLN03007 5..482 CDD:178584 58/222 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.