DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and AT4G27570

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_194487.1 Gene:AT4G27570 / 828866 AraportID:AT4G27570 Length:453 Species:Arabidopsis thaliana


Alignment Length:505 Identity:99/505 - (19%)
Similarity:168/505 - (33%) Gaps:158/505 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VFPLPSSSHYFFALPYL---KSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENFNEVLRIAS 84
            ::|..::.|   ..|:|   ..||..||.:|.:.|....:...:.:..|...||.:.. |..:..
plant    10 MYPWFATGH---MTPFLFLANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVT-VPHVDG 70

  Fly    85 TPRSTWQSSDFINEYVLNLTKTVLNNEGVRRD----ILGPQKPHFDLVIMDL--WRMDVLSGLAA 143
            .|..|..:|    |..:..|..:::...:.||    ::...:|  ||:..|.  |..:|......
plant    71 LPVGTETAS----EIPVTSTDLLMSAMDLTRDQVEAVVRAVEP--DLIFFDFAHWIPEVARDFGL 129

  Fly   144 YFDAPIIGMASYGTDWKIDELMGNVSPISYLQSPSSR--FYDLEAYGERLL----------HLME 196
            .....::..||......:......|.|..|   |||:  ....:||..:.|          :|:|
plant   130 KTVKYVVVSASTIASMLVPGGELGVPPPGY---PSSKVLLRKQDAYTMKKLEPTNTIDVGPNLLE 191

  Fly   197 R-TFSYMN------------------YKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVLVN 242
            | |.|.||                  |..:|.||:..|....||...:.:.|.|           
plant   192 RVTTSLMNSDVIAIRTAREIEGNFCDYIEKHCRKKVLLTGPVFPEPDKTRELEE----------- 245

  Fly   243 QHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSEDRR 307
                                            ....::.|.....|::.:||:.|   .|.:|:.
plant   246 --------------------------------RWVKWLSGYEPDSVVFCALGSQV---ILEKDQF 275

  Fly   308 KVL---LETFAS------------------LPQRIVWKFEDELLPGKPPNVFISKWFPQQAILAH 351
            :.|   :|...|                  ||:    .||:.:   |...:....|..|..||:|
plant   276 QELCLGMELTGSPFLVAVKPPRGSSTIQEALPE----GFEERV---KGRGLVWGGWVQQPLILSH 333

  Fly   352 PNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTII 416
            |:|..|::|.|..|..||:.....::.:|.|.||              |||.:.::.|      :
plant   334 PSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQ--------------VLNTRLLSDE------L 378

  Fly   417 RLLTNKSFEETA---------RITAARYRDQPMKPM--ETAIWWTEYVLS 455
            ::....:.|||.         .:.:...||..:..:  :....|.|.|.|
plant   379 KVSVEVAREETGWFSKESLCDAVNSVMKRDSELGNLVRKNHTKWRETVAS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 99/505 (20%)
UDPGT 30..511 CDD:278624 98/498 (20%)
AT4G27570NP_194487.1 PLN02764 1..452 CDD:178364 99/505 (20%)
MGT 15..414 CDD:273616 94/484 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.