DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and IAGLU

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_567471.1 Gene:IAGLU / 827229 AraportID:AT4G15550 Length:474 Species:Arabidopsis thaliana


Alignment Length:502 Identity:109/502 - (21%)
Similarity:178/502 - (35%) Gaps:151/502 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PSSSHYFF-----------ALPYLKSLASL--GHEIT---SVSPYPQREPFRNIHDIPVPEVFEN 75
            |:..|:.|           :|...|.||..  |..:|   |:|.|.:|  ..:..::|...:|..
plant     9 PTGPHFLFVTFPAQGHINPSLELAKRLAGTISGARVTFAASISAYNRR--MFSTENVPETLIFAT 71

  Fly    76 FNE-----VLRIASTPRSTWQSS-DFINEY----VLNLTKTVLNNEGVRRDI-----------LG 119
            :::     ....|.:.:|...:: :|::|.    ...||:.:.:|....|..           :.
plant    72 YSDGHDDGFKSSAYSDKSRQDATGNFMSEMRRRGKETLTELIEDNRKQNRPFTCVVYTILLTWVA 136

  Fly   120 PQKPHFDLVIMDLW--RMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSP----- 177
            .....|.|....||  .:.|.|....||:         |.:..|.| |.| :|.|.::.|     
plant   137 ELAREFHLPSALLWVQPVTVFSIFYHYFN---------GYEDAISE-MAN-TPSSSIKLPSLPLL 190

  Fly   178 ----------SSRFYD--LEAYGERLLHLMERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLS 230
                      ||..|.  |.|:.|::..|.|.    :|.|        .|.:.|  ...|.:.:|
plant   191 TVRDIPSFIVSSNVYAFLLPAFREQIDSLKEE----INPK--------ILINTF--QELEPEAMS 241

  Fly   231 EISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGT 295
            .:..||.:|.|....|                |..|.|:.   .|...::....:|.|:|.|.||
plant   242 SVPDNFKIVPVGPLLT----------------LRTDFSSR---GEYIEWLDTKADSSVLYVSFGT 287

  Fly   296 NVKSKSLSEDRRKVLLETFASLPQR---IVWKFEDELLPGKPPNV------------------FI 339
                  |:...:|.|:|...:|.|.   .:|...|:....|....                  .:
plant   288 ------LAVLSKKQLVELCKALIQSRRPFLWVITDKSYRNKEDEQEKEEDCISSFREELDEIGMV 346

  Fly   340 SKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRN--------------MD 390
            ..|..|..:|.|.::..|:||.|..||:||:..|.|::..|...||..|              |:
plant   347 VSWCDQFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQWNDQMMNAKLLEDCWKTGVRVME 411

  Fly   391 HVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARITAARYRD 437
            ...:.|:.:|      .|||.|..|..::.:|:  |..|..|.|::|
plant   412 KKEEEGVVVV------DSEEIRRCIEEVMEDKA--EEFRGNATRWKD 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 109/502 (22%)
UDPGT 30..511 CDD:278624 108/499 (22%)
IAGLUNP_567471.1 Glycosyltransferase_GTB_type 12..472 CDD:299143 108/499 (22%)
YjiC 13..455 CDD:224732 108/498 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.