DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt35D1 and UGT84A1

DIOPT Version :9

Sequence 1:NP_651866.1 Gene:Ugt35D1 / 43708 FlyBaseID:FBgn0051002 Length:521 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:440 Identity:99/440 - (22%)
Similarity:157/440 - (35%) Gaps:133/440 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PLPSSSHYFFAL--------PYL---KSLASLGHEITSVSPYPQREPFRNIHDIPVPEV------ 72
            |.|:..|.....        |.|   |.:||.|..:|.|:.....:..|..:.|...|:      
plant    13 PSPNPIHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKKMRQANKIVDGELKPVGSG 77

  Fly    73 ---FENFNEVLRIASTPRSTW-----QSSDFINEYVLNLTKTVLN------------NEGVRRDI 117
               ||.|:|          .|     :.:|| :.|:.:|....:.            ||.|...|
plant    78 SIRFEFFDE----------EWAEDDDRRADF-SLYIAHLESVGIREVSKLVRRYEEANEPVSCLI 131

  Fly   118 LGPQKP-------HFDLVIMDLWRMDVLSGLAAYF---DAPIIGMASYGTDWK---------IDE 163
            ..|..|       .|::....|| :...:..:||:   |    |..|:.|:.:         :..
plant   132 NNPFIPWVCHVAEEFNIPCAVLW-VQSCACFSAYYHYQD----GSVSFPTETEPELDVKLPCVPV 191

  Fly   164 LMGNVSPISYLQSPSSRFYDLEAYGERLL---HLMERTFSYMNYKWRHVRKQETLYSQFFPSVAE 225
            |..:..| |:|. |||||   ..:.:.:|   ..:.::|..:...:..:.::...|......|..
plant   192 LKNDEIP-SFLH-PSSRF---TGFRQAILGQFKNLSKSFCVLIDSFDSLEQEVIDYMSSLCPVKT 251

  Fly   226 RKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIY 290
            ..||.:::|..                    ...|.| .:..||:.....||    ...:|.|:|
plant   252 VGPLFKVARTV--------------------TSDVSG-DICKSTDKCLEWLD----SRPKSSVVY 291

  Fly   291 FSLGT--NVKSKSLSEDRRKVLLETFASLPQRIVW---------KFEDELLP---------GKPP 335
            .|.||  .:|.:.:.|....||....:.|     |         |.|..:||         ||. 
plant   292 ISFGTVAYLKQEQIEEIAHGVLKSGLSFL-----WVIRPPPHDLKVETHVLPQELKESSAKGKG- 350

  Fly   336 NVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQ 385
              .|..|.||:.:|:||:|..|:||.|..||:||:..|.|::..|...||
plant   351 --MIVDWCPQEQVLSHPSVACFVTHCGWNSTMESLSSGVPVVCCPQWGDQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt35D1NP_651866.1 egt 1..462 CDD:223071 99/440 (23%)
UDPGT 30..511 CDD:278624 97/435 (22%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 97/436 (22%)
YjiC 19..477 CDD:224732 97/434 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.